DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1c13 and CG2767

DIOPT Version :9

Sequence 1:XP_006516545.1 Gene:Akr1c13 / 27384 MGIID:1351662 Length:324 Species:Mus musculus
Sequence 2:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster


Alignment Length:319 Identity:115/319 - (36%)
Similarity:190/319 - (59%) Gaps:15/319 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 DGEKEDLVKINV--PKSKSLEAAC-LALDVGYRHVDTAYAYQVEEEIGQAIQSKIKAGVVKREDL 80
            :|||..::.|..  ...:.:|.|. .||:.||||:|||..|..|:.||:.::..:.||.||||:|
  Fly    11 NGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREEL 75

Mouse    81 FITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYPVPMK-SGDNDFPVNEQGKSLLD-TV 143
            ||.||:.....||..|:|.::|||:.|||||||||::|.|..:. :.|..|.::::|...:| |.
  Fly    76 FIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTT 140

Mouse   144 DFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQRKLLDYCE 208
            :....|..:|...:.||.||||||||:..|:.|:|.  ..|.:|..||:|.|:||.||.|:|:|:
  Fly   141 NHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLVDFCK 203

Mouse   209 SKDIVLVAYGALGTQRYKEW-----VDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLIQRGIVP 268
            |::|.:.||..||::...::     :.::.|.|::.|.:.::|..:.::||.:.||::|..|:..
  Fly   204 SENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSA 268

Mouse   269 LAQSFKENEMRENLQVFGFQLSPEDMKTLDGLNKNFRYLPAEF---LVDHPEYPFVEEY 324
            :.:|.....:::||.||.|:|:.|::..|..|::|.|.....|   :..|||:.|..:|
  Fly   269 IPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1c13XP_006516545.1 AKR_AKR1C1-35 30..309 CDD:381334 105/288 (36%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 107/292 (37%)
Tas 10..297 CDD:223739 105/287 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.