DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc25a10 and CG18327

DIOPT Version :9

Sequence 1:NP_038798.2 Gene:Slc25a10 / 27376 MGIID:1353497 Length:287 Species:Mus musculus
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:292 Identity:75/292 - (25%)
Similarity:135/292 - (46%) Gaps:24/292 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 SRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQ-----------VVRTDGFLALY 60
            |.:..||:|:.||...|:|::::|..:|.|.|:..|  |...|           |.:.||.|.|.
  Fly     4 SDFVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAAR--GSHAQPYKSVFQAFVTVAKNDGILGLQ 66

Mouse    61 NGLSASLCRQMTYSLTRFAIY-ETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNV 124
            .||:.:||.|...:..|.:|| ..:......:::|.:.|...:..|.:.|:.|.:..:|..|:..
  Fly    67 KGLAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKT 131

Mouse   125 RMQNDMKLPPSQRRNYSHA--LDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQL 187
            ::|.......:....:.||  .|.:.::.|:..:..|:.|:....||..:.:..|::.:.|||.|
  Fly   132 QLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSL 196

Mouse   188 VLSTGYLSDNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMN----SKGE---YQGVFHCAMETAK 245
            :...|.::......|.|...||...:....||||:.|||.|    ::|.   |:|...|.:...:
  Fly   197 LKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILR 261

Mouse   246 L-GPQAFFKGLFPAGIRLIPHTVLTFMFLEQL 276
            . |....:||.:|..:|..|::.|..:|.::|
  Fly   262 SEGVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc25a10NP_038798.2 Solcar 1 7..87 28/91 (31%)
Mito_carr 12..92 CDD:278578 27/91 (30%)
Mito_carr 94..189 CDD:278578 21/96 (22%)
Solcar 2 100..187 18/88 (20%)
Solcar 3 196..279 25/89 (28%)
Mito_carr 197..283 CDD:278578 25/88 (28%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 26/84 (31%)
PTZ00169 5..293 CDD:240302 73/289 (25%)
Mito_carr 101..201 CDD:278578 21/99 (21%)
Mito_carr 204..296 CDD:278578 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.