DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csnk1e and CG7094

DIOPT Version :9

Sequence 1:XP_006521106.1 Gene:Csnk1e / 27373 MGIID:1351660 Length:431 Species:Mus musculus
Sequence 2:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster


Alignment Length:346 Identity:180/346 - (52%)
Similarity:232/346 - (67%) Gaps:30/346 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIP 66
            :|.:|.||||.:.||||||||||||.:|..|.|||||:|....|:|||..|:|.|:.:....|.|
  Fly    20 KLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFP 84

Mouse    67 SIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131
            ::...|.|.:||.|||:|||||||:|||.|.|:|||||||:|.||::.|||.:|.:.|||||:||
  Fly    85 TLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149

Mouse   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196
            |||||||.:..|.:|:|||||:|:|:|..:..|||||.::|||||.||||||..:|:|||||||:
  Fly   150 DNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDM 214

Mouse   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFD 261
            ||:.|.|||||||.|||||:.||.|:||||:|.|||.|..|..||||:||||...:.:.|:|.|.
  Fly   215 ESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFK 279

Mouse   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFMRPPFHQPPALPCGRPQDQLGCSPE------ 320
            :.||::||||:||.||......|||::||..|:               :.:||:..|.|      
  Fly   280 EPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQ---------------QQKDQICRSREQILESE 329

Mouse   321 ---------SRGCRPGKTGAR 332
                     .|||.|.:...|
  Fly   330 REEVRKRDGERGCEPQRDKER 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Csnk1eXP_006521106.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 163/273 (60%)
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 159/264 (60%)
SPS1 26..>266 CDD:223589 148/239 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.