DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLI1 and esg

DIOPT Version :10

Sequence 1:NP_005260.1 Gene:GLI1 / 2735 HGNCID:4317 Length:1106 Species:Homo sapiens
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0287768 Length:470 Species:Drosophila melanogaster


Alignment Length:395 Identity:95/395 - (24%)
Similarity:141/395 - (35%) Gaps:138/395 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    22 LPSQG---APSVGTEGLS--GPPFCHQANLMSGPHSYGPARETNSCTEGPLFSSPRSAVKLTKKR 81
            ||.:|   |||..::.|.  .||          ||.|                        ...|
  Fly   154 LPLRGDLIAPSSPSDSLGSLSPP----------PHHY------------------------LHGR 184

Human    82 ALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGSYGHLSIGTMS------------PSLG 134
            |.|:||             ...|.::               |..||...            ||||
  Fly   185 ASSVSP-------------PMRSEII---------------HRPIGVRQHRFLPYPQMPGYPSLG 221

Human   135 FPAQMNHQKGP-SPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLKSELDMLVGKCREEPLE-- 196
            .....:|...| ||::..   ..:.|.| .|.|........|........::.:.....:|.|  
  Fly   222 GYTHTHHHHAPISPAYSE---NSYYSMR-SMTPESSCSSSLPEDLSLKHKNLNLNLNTSQPGEQA 282

Human   197 ----GDMS---SPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCR-----WDGCS--QEFD 247
                ||||   .||::.                :::|.:|......||:     :.|.:  |:| 
  Fly   283 AAKTGDMSPETMPNASA----------------KKDKNQPPRYQCPDCQKSYSTFSGLTKHQQF- 330

Human   248 SQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSY 312
                   |..:...:..:|.|.|.  .|.:......|   |.:|:|.||  .|.||..  |.|::
  Fly   331 -------HCPAAEGNQVKKSFSCK--DCDKTYVSLGA---LKMHIRTHT--LPCKCNL--CGKAF 379

Human   313 SRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPS 377
            ||...|:.|:|:||||||:.|:|  |.:||::.|:...|. :|||:.|.|.|  ..|:|.::..|
  Fly   380 SRPWLLQGHIRTHTGEKPFSCQH--CHRAFADRSNLRAHL-QTHSDIKKYSC--TSCSKTFSRMS 439

Human   378 SLRKH 382
            .|.||
  Fly   440 LLTKH 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLI1NP_005260.1 Interaction with SUFU. /evidence=ECO:0000269|PubMed:24217340, ECO:0000269|PubMed:24311597 120..124 0/3 (0%)
FOXP-CC 237..>265 CDD:465036 5/34 (15%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:8378770 283..291 2/7 (29%)
SFP1 <297..387 CDD:227516 35/86 (41%)
C2H2 Zn finger 303..325 CDD:275368 8/21 (38%)
C2H2 Zn finger 333..356 CDD:275368 7/22 (32%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:8378770 345..350 1/4 (25%)
C2H2 Zn finger 364..385 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 375..485 4/8 (50%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:8378770 375..381 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..580
PHA03247 <562..1081 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 732..792
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 817..889
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 914..942
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1054..1087
SNAG domain. /evidence=ECO:0000250 1..20
esgNP_476600.1 KREPA <278..>329 CDD:483960 13/66 (20%)
zf-C2H2 309..331 CDD:395048 5/29 (17%)
C2H2 Zn finger 311..331 CDD:275370 5/27 (19%)
zf-C2H2 344..366 CDD:395048 7/26 (27%)
C2H2 Zn finger 346..366 CDD:275368 6/24 (25%)
zf-C2H2 370..392 CDD:395048 9/23 (39%)
C2H2 Zn finger 372..392 CDD:275368 8/21 (38%)
zf-H2C2_2 385..408 CDD:463886 13/24 (54%)
zf-C2H2 398..420 CDD:395048 7/24 (29%)
C2H2 Zn finger 400..420 CDD:275368 7/22 (32%)
C2H2 Zn finger 428..444 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.