DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TOR1B and RPT3

DIOPT Version :9

Sequence 1:NP_055321.1 Gene:TOR1B / 27348 HGNCID:11995 Length:336 Species:Homo sapiens
Sequence 2:NP_010682.3 Gene:RPT3 / 852003 SGDID:S000002802 Length:428 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:39/168 - (23%)
Similarity:68/168 - (40%) Gaps:24/168 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   102 PLTLSLHGWAGTGKNFVSQIVAENLHPKGLK---SNFVHLFVSTLHFPHEQKIKLYQDQLQKWIR 163
            |..:.|:|..||||..:.:.||.:.....::   |.|||.::.       :..::.:| :.:..|
Yeast   206 PRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLG-------EGPRMVRD-VFRLAR 262

Human   164 GNVSACANSVFIFDEMDKLHPGIIDA--------IKPFLDYYEQVDGVSYRKAIFIFLSNAGGDL 220
            .|    |.|:...||:|.:.....||        .:..::...|:||......:.:.::....|.
Yeast   263 EN----APSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADT 323

Human   221 ITKTALDFWRAGRKREDIQLKD-LEPVLSVGVFNNKHS 257
            :....|...|..||.|...|:| .|..|..|...:|.|
Yeast   324 LDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TOR1BNP_055321.1 Torsin 51..176 CDD:148114 18/76 (24%)
ClpA <68..313 CDD:274241 39/168 (23%)
RPT3NP_010682.3 PTZ00454 46..428 CDD:240423 39/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.