DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TOR1B and HSP104

DIOPT Version :9

Sequence 1:NP_055321.1 Gene:TOR1B / 27348 HGNCID:11995 Length:336 Species:Homo sapiens
Sequence 2:NP_013074.1 Gene:HSP104 / 850633 SGDID:S000003949 Length:908 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:50/222 - (22%)
Similarity:85/222 - (38%) Gaps:56/222 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    68 LKLDLEEKLFGQHLATEVIFKALTGFRNN-KNPKKPLTLSLHGWAGTGKNFVSQIVA-------- 123
            ::.||..::.||..|.:.:..|:...|:. .||::|.:....|.:|:||..:::.||        
Yeast   572 MERDLSSEVVGQMDAIKAVSNAVRLSRSGLANPRQPASFLFLGLSGSGKTELAKKVAGFLFNDED 636

Human   124 -------ENLHPKGLKSNFVHLFVSTLHFPHEQKIKLYQDQLQKWIRGNVSACANSVFIFDEMDK 181
                   ..|..|...|.   |..:|..:....:.....:|||        ....||.:|||::|
Yeast   637 MMIRVDCSELSEKYAVSK---LLGTTAGYVGYDEGGFLTNQLQ--------YKPYSVLLFDEVEK 690

Human   182 LHPGIIDAIKPFLDYYEQVDG---------VSYRKAIFIFLSNAGGDLI-----------TKTAL 226
            .||.::..:...||     ||         :.....|.|..||.|.:.|           ||..:
Yeast   691 AHPDVLTVMLQMLD-----DGRITSGQGKTIDCSNCIVIMTSNLGAEFINSQQGSKIQESTKNLV 750

Human   227 DFWRAGRKREDIQLKDLEPVLSVGVFN 253
                .|..|:..:.:.|..:.|:.:||
Yeast   751 ----MGAVRQHFRPEFLNRISSIVIFN 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TOR1BNP_055321.1 Torsin 51..176 CDD:148114 26/123 (21%)
ClpA <68..313 CDD:274241 50/222 (23%)
HSP104NP_013074.1 chaperone_ClpB 7..863 CDD:274529 50/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.