DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TOR1B and Torsin

DIOPT Version :9

Sequence 1:NP_055321.1 Gene:TOR1B / 27348 HGNCID:11995 Length:336 Species:Homo sapiens
Sequence 2:NP_001284866.1 Gene:Torsin / 31399 FlyBaseID:FBgn0025615 Length:340 Species:Drosophila melanogaster


Alignment Length:337 Identity:121/337 - (35%)
Similarity:185/337 - (54%) Gaps:25/337 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    13 LALLLAARVV-----AAFEPITVGLAIGAASAITGYLSYNDIYCRFAECCREER-PLNASALKLD 71
            |:|.|:..|:     .:.:|:|:| |:||. |:..|.. ...||||||||.:.. |.....|:..
  Fly     8 LSLCLSVLVILPLPLQSVDPLTIG-AVGAV-ALGAYFK-EHTYCRFAECCDDRNIPARIDELERS 69

Human    72 LEEKLFGQHLATEVIFKALTGF--RNNKNPKKPLTLSLHGWAGTGKNFVSQIVAENLHPKGLKSN 134
            ||..|.|||:..:.|..||...  ..||: :|||.:|.||..|||||||::.:|:.::.||.:||
  Fly    70 LERTLIGQHIVRQHIVPALKAHIASGNKS-RKPLVISFHGQPGTGKNFVAEQIADAMYLKGSRSN 133

Human   135 FVHLFVSTLHFPHEQKIKLYQDQLQKWIRGNVSACANSVFIFDEMDKLHPGIIDAIKPFLDYYEQ 199
            :|..::....||.|.::..|:.::...:|..:.:|..|:|||||:||:..|:.|.:...:||...
  Fly   134 YVTKYLGQADFPKESEVSNYRVKINNAVRDTLRSCPRSLFIFDEVDKMPSGVFDQLTSLVDYNAF 198

Human   200 VDGVSYRKAIFIFLSNAGGDLITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGL 264
            |||....|||||||||..|..|........:.||.|||.:|.|.||:|....: |...|:..:.:
  Fly   199 VDGTDNTKAIFIFLSNTAGSHIASHLGSVMKNGRLREDTRLSDFEPLLRKAAY-NMDGGMKKTTM 262

Human   265 IDKNLIDYFIPFLPLEYRHVKMCVRAEM--------RARGSAIDEDIVTRVAEEMTFFPRDEKIY 321
            |:.::||:||||||:|..||..|:.||:        :|....|.|||:    .....:.|...::
  Fly   263 IESHVIDHFIPFLPMEKAHVIKCLEAELLRWRRDPKQANNQKIIEDII----NSSISYDRTHSLF 323

Human   322 SDKGCKTVQSRL 333
            :..||||::.::
  Fly   324 AISGCKTLEKKV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TOR1BNP_055321.1 Torsin 51..176 CDD:148114 47/127 (37%)
ClpA <68..313 CDD:274241 95/254 (37%)
TorsinNP_001284866.1 P-loop_NTPase 48..175 CDD:304359 47/127 (37%)
AAA 100..224 CDD:214640 51/123 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147052
Domainoid 1 1.000 106 1.000 Domainoid score I6568
eggNOG 1 0.900 - - E1_KOG2170
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3713
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49139
OrthoDB 1 1.010 - - D1453168at2759
OrthoFinder 1 1.000 - - FOG0001199
OrthoInspector 1 1.000 - - otm40398
orthoMCL 1 0.900 - - OOG6_104781
Panther 1 1.100 - - O PTHR10760
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3548
SonicParanoid 1 1.000 - - X455
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.