DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RABGEF1 and Gapvd1

DIOPT Version :9

Sequence 1:NP_001354670.1 Gene:RABGEF1 / 27342 HGNCID:17676 Length:530 Species:Homo sapiens
Sequence 2:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster


Alignment Length:163 Identity:52/163 - (31%)
Similarity:84/163 - (51%) Gaps:8/163 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   250 IEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRAL-RWVTP--QMLCVPVNEDIPEVSDMVVKAI 311
            ||:.::.::|:.|..|....|..:|..:...|..| |:|.|  ..||: ..|.:.|..  ...|.
  Fly  1552 IERMLLEQMYEQVMFPNEDADVSRDEVLSAHIGKLQRFVHPAHPALCI-AQEYLGEAP--WTFAQ 1613

Human   312 TDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQY 376
            ..:..|.:.:.||:||.||..|...|.:.::::.....:|||.||.|||:|:..|||.|.|.::|
  Fly  1614 QQLCHMAAYKTPREKLQCIINCISSIMSLLRMSSGRVPAADDLLPVLIYVVIMANPPYLLSTVEY 1678

Human   377 ITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLD 409
            |:  |...:.:.|||.:|:|.....|.||:.:|
  Fly  1679 IS--CFLGKKLEGEDEFYWTLFGSVVKFIKTMD 1709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RABGEF1NP_001354670.1 None
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
VPS9 1609..1709 CDD:280383 35/101 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.