Protein Alignment RBMX and rbm-42

DIOPT Version :9

• Sequence 1: NP_002130.2
• Gene: RBMX / 27316
• HGNCID: 9910
• Length: 391
• Species: Homo sapiens
• Sequence 2: NP_498090.1
• Gene: rbm-42 / 175700
• WormBaseID: WBGene00021901
• Length: 302
• Species: Caenorhabditis elegans
• Alignment Length: 76
• Identity: 24/76 - (31%)
• Similarity: 44/76 - (57%)
• Gaps: 0/76 - (0%)

Human     9 KLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKS 73
            ::|.|.|..|.:::.|...|.||....:..::::..||||:|:.||:|....|...|.|:|:||.
 Worm   204 RVFCGDLGNEVSDELLAKAFRKYPSFQKAKVVRESRTNKSKGYGFVSFRDSEDYVRAMREMDGKY 268

Human    74 LDGKAIKVEQA 84
            :..:.||:.::
 Worm   269 VGNRPIKLRKS 279

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
RBMX	NP_002130.2	RRM_RBMX_like	7..86	CDD:409816	24/76 (32%)
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	61..391		8/24 (33%)
		dnaA	165..>306	CDD:237605
		RBM1CTR	173..217	CDD:400429
		Necessary for the association to nascent RNAPII transcripts and nuclear localization	186..236
		Necessary for RNA-binding	333..391
rbm-42	NP_498090.1	RRM_RBM42	197..279	CDD:240829	24/74 (32%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0226
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.900