Sequence 1: | NP_001272988.1 | Gene: | RAB30 / 27314 | HGNCID: | 9770 | Length: | 203 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_732610.1 | Gene: | Rab1 / 42524 | FlyBaseID: | FBgn0285937 | Length: | 205 | Species: | Drosophila melanogaster |
Alignment Length: | 199 | Identity: | 88/199 - (44%) |
---|---|---|---|
Similarity: | 131/199 - (65%) | Gaps: | 3/199 - (1%) |
- Green bases have known domain annotations that are detailed below.
Human 5 DYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQE 69
Human 70 RFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQ 134
Human 135 QRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISE-ARQNTLVNNVSSPLPGEGKSISYLT 198
Human 199 --CC 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RAB30 | NP_001272988.1 | Rab30 | 3..171 | CDD:133314 | 83/165 (50%) |
Effector region. /evidence=ECO:0000250 | 38..46 | 4/7 (57%) | |||
Rab1 | NP_732610.1 | Rab1_Ypt1 | 10..175 | CDD:206661 | 81/164 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1149105at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |