DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB30 and RabX2

DIOPT Version :9

Sequence 1:NP_001272988.1 Gene:RAB30 / 27314 HGNCID:9770 Length:203 Species:Homo sapiens
Sequence 2:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster


Alignment Length:188 Identity:69/188 - (36%)
Similarity:114/188 - (60%) Gaps:4/188 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     3 MEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAG 67
            |..:|:|||::::|::||||:||:.||:...|......|:|:|...::||:....:.||:|||:|
  Fly     1 MSHFDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSG 65

Human    68 QERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREV 132
            .:||.|:..|.||||:.::|.||||..:||:.:..|::||.:...:||..:|||||.|....|:|
  Fly    66 DKRFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQV 130

Human   133 SQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGE 190
            |.::...::....:.:.|.|||...||..:|..||    .:.....:::|..||:|.|
  Fly   131 SMEQGFNYAHRGALGFEEVSAKSGMNVYDIFSSLA----MDIYHRYVLHNPISPMPSE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB30NP_001272988.1 Rab30 3..171 CDD:133314 64/167 (38%)
Effector region. /evidence=ECO:0000250 38..46 2/7 (29%)
RabX2NP_572627.1 RAB 8..171 CDD:197555 61/166 (37%)
Rab 8..165 CDD:206640 59/156 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.