DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB30 and ypt2

DIOPT Version :9

Sequence 1:NP_001272988.1 Gene:RAB30 / 27314 HGNCID:9770 Length:203 Species:Homo sapiens
Sequence 2:NP_594580.1 Gene:ypt2 / 2543280 PomBaseID:SPAC9E9.07c Length:200 Species:Schizosaccharomyces pombe


Alignment Length:203 Identity:85/203 - (41%)
Similarity:136/203 - (66%) Gaps:6/203 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDT 65
            ||.:.||:|.|::|||::||||:||:.||::..|.|....|||:||.|:|:|::|:::|||||||
pombe     1 MSTKSYDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGKRIKLQIWDT 65

Human    66 AGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERR 130
            |||||||:||.:|||.|..::|.||:|.::||..:..|...:||:||..|..:|:|||.|..::|
pombe    66 AGQERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHASENVYKILIGNKCDCEDQR 130

Human   131 EVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEAR---QNTLVNNVSSPLPGEGK 192
            :||.::.:..::...:.:||.|||.:.||::.|..|| |.|.:.:   :|...|..::...|..:
pombe   131 QVSFEQGQALADELGVKFLEASAKTNVNVDEAFFTLA-REIKKQKIDAENEFSNQANNVDLGNDR 194

Human   193 SISYLTCC 200
            ::.  .||
pombe   195 TVK--RCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB30NP_001272988.1 Rab30 3..171 CDD:133314 77/167 (46%)
Effector region. /evidence=ECO:0000250 38..46 3/7 (43%)
ypt2NP_594580.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 77/166 (46%)
Ras 11..172 CDD:278499 75/161 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.