DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BMP10 and scw

DIOPT Version :9

Sequence 1:NP_055297.1 Gene:BMP10 / 27302 HGNCID:20869 Length:424 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:491 Identity:119/491 - (24%)
Similarity:186/491 - (37%) Gaps:167/491 - (34%)


- Green bases have known domain annotations that are detailed below.


Human     5 VLTLCALFCLAA---YLVSGS----PIMNLEQSPLEEDMSLFGDVFSEQDGVDFNTLLQSMKDEF 62
            |..|.:||..|:   |:.:.:    ||  .::.||.|.|                        |.
  Fly     4 VFFLTSLFYAASATTYVTTNNHIEMPI--YQKRPLSEQM------------------------EM 42

Human    63 LKTLNLSDIPTQDSAKVDP------PEYMLELYNKFA-------------------------TDR 96
            :..|:|.|.|.:   :.:|      .:::||:||:.:                         .||
  Fly    43 IDILDLGDRPRR---QAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILISNEDR 104

Human    97 TSMPSANIIRSFKNEDLFSQPVSFNGLRKYPLLFNVS-IPHHEEVIMAELRLY---TLVQRDRMI 157
            ..:.|.|.|.:|.:.   .:|...:......:.||.: :|....::.|.||:|   :||.|....
  Fly   105 QEIASCNSILTFSSR---LKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANF 166

Human   158 YDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSE--WETFDVTDAIRRWQKSGSSTHQL 220
            ...|.||:          ||..:.:..:|  |.:..|:|:  |..|::||.:|.|          
  Fly   167 TVSVYRKL----------DNRQDFSYRIL--GSVNTTSSQRGWLEFNLTDTLRYW---------- 209

Human   221 EVHIESKHDEAEDASSGRLEIDTSAQNKHNPLLIVFSDDQSSDKERKEELNEMISHEQL------ 279
                                       .||..|           :|:.||...|...||      
  Fly   210 ---------------------------LHNKGL-----------QRRNELRISIGDSQLSTFAAG 236

Human   280 ---PELDNLGLDSFSSG--PGEEALLQMRSNIIYDSTARIRRNAKGN----------------YC 323
               |:.....|:.|..|  .|.|.|:::: .:.:......||...|:                .|
  Fly   237 LVTPQASRTSLEPFIVGYFNGPELLVKIQ-KLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSC 300

Human   324 KRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKAC 388
            :|....:||||:...:|:|||..:|||.|.|.||:||...:..|.|||:|.|:|||... ..|.|
  Fly   301 ERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPH-LPKPC 364

Human   389 CVPTKLEPISIL-YLDKGVVTYKFKYEGMAVSECGC 423
            ||||.|..|:|| ||::.::... ||:.....||||
  Fly   365 CVPTVLGAITILRYLNEDIIDLT-KYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BMP10NP_055297.1 TGFb_propeptide 55..256 CDD:279078 45/237 (19%)
TGF_beta 321..423 CDD:278448 44/118 (37%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 55/304 (18%)
TGFB 300..400 CDD:214556 46/102 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.