DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF544 and CG6689

DIOPT Version :9

Sequence 1:NP_001374339.1 Gene:ZNF544 / 27300 HGNCID:16759 Length:769 Species:Homo sapiens
Sequence 2:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster


Alignment Length:635 Identity:154/635 - (24%)
Similarity:242/635 - (38%) Gaps:192/635 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    46 SGLFRCREEMEAR--------SMLVPPQASVCFEDVAMAFTQEEWEQLDLAQRTLY--REVTLET 100
            ||..|.|:|...|        .:|...:|.:...: |.:|.|:          ::|  ..||:|.
  Fly    99 SGSDRARKERSQRRRNQELVAELLAEEEAKLIHPE-ATSFEQD----------SVYLSETVTMEL 152

Human   101 WEHIVSLGLFLSKSDVISQLEQEEDL--CRAEQEAPRDWKATLEENRLNSEKDRAREELSHHVEV 163
                          |.:|..|:.|:|  ||.   ...|:.|   :.|.....|.|...|..|:||
  Fly   153 --------------DPLSGEEKLEELQKCRT---CYNDFTA---DFRAKDLFDPANSVLLFHIEV 197

Human   164 YRSG------PEEPPSL--VLGKVQDQSNQLREHQENSLRFMVLTSERLFAQ----REHCELELG 216
            . ||      |:||..:  ......||:...||        |.:::|...:|    .:..::|..
  Fly   198 I-SGVWISHKPDEPRLMCPACKSALDQAIDFRE--------MCISTELKLSQAKPSTDEVQIEAE 253

Human   217 GGYSLPSTLSLLPTTLPTSTGFPKPNSQVKELKQNSAFINHEKNGADGKHCESHQCARAFCQS-- 279
            ....:.|...|:..|         .|:.|:|::....  :|.::.|......|.:......:|  
  Fly   254 NENPISSDHDLISDT---------ENTNVEEIEDAGG--DHVEDEATSDDQTSQEAVDEVAESPA 307

Human   280 ------------IYLSKLGNVETGKKNPYEYIVSGDSLNYGSSLCFHGRTFSVKKSDDCKDYGNL 332
                        |: .:|.:..|||:..        .|..|:.:.      |..|:.:       
  Fly   308 AQDPLSVALGAKIF-KELLDQYTGKEKA--------RLRKGAPIA------SKPKAKE------- 350

Human   333 FSHSVSLNEQKPVHFGKSQYECDECRETCSESLCLVQTERSGPGETPFRCEERCAAFPMASSFSD 397
                .:..||||                          :||...:|.   |||            
  Fly   351 ----KAAGEQKP--------------------------KRSANPKTK---EER------------ 370

Human   398 CNII---QTTEKPS--VCNQCGKSF--SCCKLIHQRTHTGEKPFECTQCGKSFSQSYDLVIHQR- 454
             |:|   |...||.  ||:|||::|  |....||...||..|.::||:|.|:|..:|...:|.| 
  Fly   371 -NLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRI 434

Human   455 THTGEKPYECDLCGKSFTQRSKLITHQ-RIHTGEKPYQCIECRKSFRWNSNLIVHQRIHTGEKP- 517
            .|.||.|:.|..|.::|........|: .:|...               ..||| :||:....| 
  Fly   435 RHRGETPFACGFCSETFAYPGARQKHESEVHNAA---------------PRLIV-KRINPKPMPK 483

Human   518 ------YECTHCGKSFSQSYELVTHKRTHTGEKPFKCTQCGKSFSQKYDLVVHQRTHTGEKPYEC 576
                  |:|..|.|.::..|.|..|.::||....:||.:|.||:|....|..|:.||. ::|.:|
  Fly   484 PRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHE-KRPLQC 547

Human   577 NLCGKSFSQSSKLITHQRIHTGEKPYQCIECGKSFRWNSNLVIH--QRIH 624
            ::|.|.|.|.::|..|:.|||||:||.|..|..:||:..|:..|  .::|
  Fly   548 DVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMH 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF544NP_001374339.1 KRAB 68..127 CDD:214630 12/62 (19%)
C2H2 Zn finger 410..428 CDD:275368 8/19 (42%)
zf-H2C2_2 424..445 CDD:404364 9/20 (45%)
C2H2 Zn finger 436..456 CDD:275368 8/20 (40%)
COG5048 460..>753 CDD:227381 53/175 (30%)
C2H2 Zn finger 464..484 CDD:275368 4/20 (20%)
C2H2 Zn finger 492..512 CDD:275368 4/19 (21%)
C2H2 Zn finger 520..540 CDD:275368 6/19 (32%)
C2H2 Zn finger 548..568 CDD:275368 7/19 (37%)
C2H2 Zn finger 576..596 CDD:275368 7/19 (37%)
C2H2 Zn finger 604..624 CDD:275368 6/21 (29%)
C2H2 Zn finger 632..652 CDD:275368
C2H2 Zn finger 660..680 CDD:275368
C2H2 Zn finger 688..708 CDD:275368
C2H2 Zn finger 716..736 CDD:275368
C2H2 Zn finger 744..764 CDD:275368
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 22/87 (25%)
zf-C2H2 385..407 CDD:278523 9/21 (43%)
C2H2 Zn finger 387..407 CDD:275368 8/19 (42%)
zf-H2C2_2 399..422 CDD:290200 9/22 (41%)
C2H2 Zn finger 415..436 CDD:275368 8/20 (40%)
C2H2 Zn finger 444..460 CDD:275368 3/15 (20%)
C2H2 Zn finger 492..512 CDD:275368 6/19 (32%)
C2H2 Zn finger 520..540 CDD:275368 7/19 (37%)
C2H2 Zn finger 547..567 CDD:275368 7/19 (37%)
zf-met 574..597 CDD:289631 6/22 (27%)
C2H2 Zn finger 575..591 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.