powered by:
Protein Alignment SPINK4 and Fs
DIOPT Version :9
Sequence 1: | NP_055286.1 |
Gene: | SPINK4 / 27290 |
HGNCID: | 16646 |
Length: | 86 |
Species: | Homo sapiens |
Sequence 2: | NP_652376.2 |
Gene: | Fs / 2768836 |
FlyBaseID: | FBgn0259878 |
Length: | 767 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 19/47 - (40%) |
Similarity: | 25/47 - (53%) |
Gaps: | 1/47 - (2%) |
- Green bases have known domain annotations that are detailed below.
Human 41 VESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQ-DIQIMKDGKC 86
:.:|...|.||.||||||.||..||||.....:|.. .:::...|.|
Fly 558 IYAPLPPQHSNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRGHC 604
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3649 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.