DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMXL2 and Rox8

DIOPT Version :10

Sequence 1:NP_055284.3 Gene:RBMXL2 / 27288 HGNCID:17886 Length:392 Species:Homo sapiens
Sequence 2:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:125 Identity:41/125 - (32%)
Similarity:65/125 - (52%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    10 LFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMNGKSL 74
            :|:|.|:.|.:.:.|...|..:|.|....:::|..|.||:|:|||:|...|:|:.|.:.|||:.:
  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161

Human    75 DGKAIKVAQATKPAFESSRRGPPPPR--SRGRPRFLRGTRGGGGGPRRSPSRGGPDDDGG 132
            ..::|:...:|        |..||||  |:|      |.:|||.|       |||.:..|
  Fly   162 GSRSIRTNWST--------RKLPPPREPSKG------GGQGGGMG-------GGPGNGSG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMXL2NP_055284.3 RRM_RBMX_like 7..86 CDD:409816 24/75 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..392 21/68 (31%)
RBM1CTR 173..217 CDD:400429
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788
RRM2_TIA1_like 96..170 CDD:409789 24/72 (33%)
RRM_SF 221..292 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.