DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cntn6 and robo2

DIOPT Version :9

Sequence 1:NP_037357.1 Gene:Cntn6 / 27256 RGDID:62008 Length:1028 Species:Rattus norvegicus
Sequence 2:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster


Alignment Length:1171 Identity:271/1171 - (23%)
Similarity:406/1171 - (34%) Gaps:340/1171 - (29%)


- Green bases have known domain annotations that are detailed below.


  Rat     2 RLLWKLVILLPLINSC--AGESRFTRPIFIQEPQDVIFPLDLSRSEIILSCTASGYPSPHYRWKQ 64
            |.::.|::||..:|..  .|..:...|..|:.|.|...|   .......:|.|.|.|:|..:|.:
  Fly    65 RAVFPLLLLLAGLNGLTQVGALKGENPRIIEHPMDTTVP---KNDPFTFNCQAEGNPTPTIQWFK 126

  Rat    65 NGTDIDFSMTYHYRLDGGSLAISSP------------RTDQDIGIYQCLATNPVGTILSRKAKLQ 117
            :|.::        :.|.||..|..|            |.:.|.|.|.|.|.|..|...||.|.||
  Fly   127 DGREL--------KTDTGSHRIMLPAGGLFFLKVIHSRRESDAGTYWCEAKNEFGVARSRNATLQ 183

  Rat   118 FAYIEDFETKSRSTVSVREGQGVVLLCGPPPHFGELSYDWTFNDNPLYVQEDKR-RFVSQNTGNL 181
            .|::.|......:...|.:|:..::.||.|....|....|..|...|.:..:|| |.|  :.|||
  Fly   184 VAFLRDEFRLEPANTRVAQGEVALMECGAPRGSPEPQISWRKNGQTLNLVGNKRIRIV--DGGNL 246

  Rat   182 YIAKVEPSDVGNYTCFVTNKEAHRSVQGPPTPLVQRTDGVMGEYEP-----KIEV-----RFPET 236
            .|.:...||.|.|.|.|.|                    |:|..|.     |:.|     |.|:.
  Fly   247 AIQEARQSDDGRYQCVVKN--------------------VVGTRESATAFLKVHVRPFLIRGPQN 291

  Rat   237 IQAAKDSSVKLECFALGNPVPDISWRR-LDGSPMPGKVKYSNSQATLEIPKFQQEDEGFYECVAG 300
            ..|...|||..:|...|:|:||:.||| ..|..||.:..:.....:|::.....||.|.|.|.|.
  Fly   292 QTAVVGSSVVFQCRIGGDPLPDVLWRRTASGGNMPLRRVHVLEDRSLKLDDVTLEDMGEYTCEAD 356

  Rat   301 NLRGRNLAKGQLIFYAPPEWEQKIQNTYLSIYDSLFWECKASGNPNPSYTWLKNGERLNTEERIQ 365
            |..|...|.|.|..:|||::..:.:|..:.|.|.:.:||:|:|:|.|:..|...|          
  Fly   357 NAVGGITATGILTVHAPPKFVIRPKNQLVEIGDEVLFECQANGHPRPTLYWSVEG---------- 411

  Rat   366 TENGTLIITMLNVSDSGIYQCAAENKYQTIYANAELRVLASAPDFSKNPIKKISVVQVGGDISIE 430
              |.:|::                                  |.:.            .|.:.:.
  Fly   412 --NSSLLL----------------------------------PGYR------------DGRMEVT 428

  Rat   431 CKPNAFPKASISWKRGTENLKQSKRVFFLEDGSLKICNVTRSDAGS-YTCVATNQFGNGKSSGSL 494
            ..|                  :.:.|       |.|....|.|:|. .||.|.|..|:       
  Fly   429 LTP------------------EGRSV-------LSIARFAREDSGKVVTCNALNAVGS------- 461

  Rat   495 IVKERTVITV------PPSKMD-------VTVGESIVLPCQVSHDPTMEVLFVWYFNGDVIDLKK 546
             |..|||::|      ||..::       :.|...:||||:....|..:|  .||.:|..||   
  Fly   462 -VSSRTVVSVDTQFELPPPIIEQGPVNQTLPVKSIVVLPCRTLGTPVPQV--SWYLDGIPID--- 520

  Rat   547 GVAHFERIGGESVGDLMIRNIQLGH-SGKYLCTVQ--------TTLERLSAVADIIVR------- 595
             |...||......|.|.|.::|... .|.|.|...        :...||....:..::       
  Fly   521 -VQEHERRNLSDAGALTISDLQRHEDEGLYTCVASNRNGKSSWSGYLRLDTPTNPNIKFFRAPEL 584

  Rat   596 ----GPPGPPEDVKVEHISSTTSQLSW-RPGPDNNSPIQIFTIQ----TRTPFSVGWQAVATVPE 651
                ||||.|:.|:....|.|   ||| |......|.:..:.|:    ..|.   ||.||.|   
  Fly   585 STYPGPPGKPQMVEKGENSVT---LSWTRSNKVGGSSLVGYVIEMFGKNETD---GWVAVGT--- 640

  Rat   652 ILNGQTYNATVIGLSPWVEYEFRVVAGNNIGIGEPSKPSE--------------LLRTKASIPNV 702
              ..|....|..||.|.|.|.|.:.|.|:.|:..||..||              |...:||:.:.
  Fly   641 --RVQNTTFTQTGLLPGVNYFFLIRAENSHGLSLPSPMSEPITVGTRYFNSGLDLSEARASLLSG 703

  Rat   703 APVNI-NGGGGSRSELVITWEPIPEELQNG---EGFGYI--------IMFRP----------VGS 745
            ..|.: |......:.:.:||:.|     ||   ||| |:        |:..|          :||
  Fly   704 DVVELSNASVVDSTSMKLTWQII-----NGKYVEGF-YVYARQLPNPIVNNPAPVTSNTNPLLGS 762

  Rat   746 TTWMKEKVALVESSKFIYRNESI------------------MPLSPFEVKVGVYNNEG------- 785
            |:  ....|...:|..|....:|                  .||:.....:.:.|..|       
  Fly   763 TS--TSASASASASALISTKPNIAAAGKRDGETNQSGGGAPTPLNTKYRMLTILNGGGASSCTIT 825

  Rat   786 -------------------EGSLSTVSIVYSGEDEPRLAPRGTSVQSFSASDMEVSWNAIAWNRN 831
                               ||..|...|..:.||.|..||.|......::|.:.:.|.|......
  Fly   826 GLVQYTLYEFFIVPFYKSVEGKPSNSRIARTLEDVPSEAPYGMEALLLNSSAVFLKWKAPELKDR 890

  Rat   832 TGRVLGYEVLYW---TDNSKESMIGKIRVSGNVTTKNITGLRANTIYFASVRAYNTAGTGPSSPP 893
            .|.:|.|.|:..   |.::...::..:.:.....|..:..|....:|...|.|.|.||.||...|
  Fly   891 HGVLLNYHVIVRGIDTAHNFSRILTNVTIDAASPTLVLANLTEGVMYTVGVAAGNNAGVGPYCVP 955

  Rat   894 VNV----TTKKSPPSQPPANIAWKLSNSKLCLNWEHVKTMENE-------SEVLGYKIL------ 941
            ..:    .||:..|          ..|.:..:|.:||..:..:       ..:|...:|      
  Fly   956 ATLRLDPITKRLDP----------FINQRYPINQDHVNDVLTQPWFIILLGAILAVLMLSFGAMV 1010

  Rat   942 -----YRQNRQSKTHVLETNNTSAELLVPF-----EEDYLIEIRT------VSDGGDGSSSEEIR 990
                 :...:||..:.:..|:||..|.:|.     ...|.::..|      .|.|||....::..
  Fly  1011 FVKRKHMMMKQSALNTMRGNHTSDVLKMPSLSARNGNGYWLDSSTGGMVWRPSPGGDSLEMQKDH 1075

  Rat   991 I 991
            |
  Fly  1076 I 1076

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cntn6NP_037357.1 Ig strand D 76..80 CDD:409353 0/3 (0%)
Ig strand E 82..88 CDD:409353 3/5 (60%)
Ig strand F 95..104 CDD:409353 4/8 (50%)
Ig strand G 107..120 CDD:409353 6/12 (50%)
Ig 129..214 CDD:416386 24/85 (28%)
Ig strand A 130..135 CDD:409353 0/4 (0%)
Ig strand B 139..145 CDD:409353 0/5 (0%)
Ig strand C 153..159 CDD:409353 1/5 (20%)
Ig strand C' 164..166 CDD:409353 1/1 (100%)
Ig strand D 171..176 CDD:409353 3/5 (60%)
Ig strand E 179..183 CDD:409353 3/3 (100%)
Ig strand F 193..201 CDD:409353 3/7 (43%)
Ig strand G 203..214 CDD:409353 0/10 (0%)
Ig 227..315 CDD:416386 31/98 (32%)
Ig strand A 227..232 CDD:409353 2/14 (14%)
Ig strand A' 235..240 CDD:409353 0/4 (0%)
Ig strand B 243..252 CDD:409353 4/8 (50%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand C' 265..267 CDD:409353 0/1 (0%)
Ig strand D 276..279 CDD:409353 0/2 (0%)
Ig strand E 280..285 CDD:409353 1/4 (25%)
Ig strand F 293..301 CDD:409353 4/7 (57%)
Ig strand G 304..315 CDD:409353 4/10 (40%)
Ig 319..403 CDD:416386 13/83 (16%)
Ig strand A 319..322 CDD:409353 0/2 (0%)
Ig strand A' 326..330 CDD:409353 1/3 (33%)
Ig strand B 334..342 CDD:409353 2/7 (29%)
Ig strand C 348..353 CDD:409353 1/4 (25%)
Ig strand C' 355..358 CDD:409353 1/2 (50%)
Ig strand D 363..367 CDD:409353 0/3 (0%)
Ig strand E 369..374 CDD:409353 1/4 (25%)
Ig strand F 383..390 CDD:409353 0/6 (0%)
Ig strand G 394..403 CDD:409353 0/8 (0%)
Ig5_Contactin 408..496 CDD:409358 14/88 (16%)
Ig strand B 427..431 CDD:409358 0/3 (0%)
Ig strand C 440..444 CDD:409358 0/3 (0%)
Ig strand E 462..466 CDD:409358 1/3 (33%)
Ig strand F 476..481 CDD:409358 2/5 (40%)
Ig strand G 489..492 CDD:409358 0/2 (0%)
Ig 500..598 CDD:416386 30/130 (23%)
Ig strand A' 507..512 CDD:409353 0/11 (0%)
Ig strand B 515..523 CDD:409353 4/7 (57%)
Ig strand C 532..536 CDD:409353 0/3 (0%)
Ig strand E 560..564 CDD:409353 2/3 (67%)
Ig strand F 573..580 CDD:409353 3/6 (50%)
Ig strand G 587..591 CDD:409353 0/3 (0%)
FN3 598..691 CDD:238020 31/97 (32%)
FN3 703..796 CDD:238020 28/158 (18%)
FN3 805..898 CDD:238020 22/99 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..908 6/24 (25%)
FN3 903..983 CDD:214495 19/108 (18%)
Ig 26..120 CDD:416386 30/105 (29%)
Ig strand A 27..31 CDD:409353 1/3 (33%)
Ig strand A' 34..39 CDD:409353 1/4 (25%)
Ig strand B 45..53 CDD:409353 1/7 (14%)
Ig strand C 58..64 CDD:409353 2/5 (40%)
Ig strand C' 66..69 CDD:409353 1/2 (50%)
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317 30/105 (29%)
I-set 91..184 CDD:254352 29/103 (28%)
I-set 190..279 CDD:254352 27/110 (25%)
Ig2_Robo 193..279 CDD:143201 27/107 (25%)
I-set 283..370 CDD:254352 29/86 (34%)
Ig 300..370 CDD:299845 24/69 (35%)
Ig 388..>457 CDD:299845 23/151 (15%)
I-set 479..561 CDD:254352 22/87 (25%)
Ig 496..561 CDD:143165 21/70 (30%)
FN3 588..681 CDD:238020 35/103 (34%)
FN3 <817..856 CDD:238020 5/38 (13%)
fn3 864..952 CDD:278470 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.