DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF115 and CG6923

DIOPT Version :9

Sequence 1:NP_055270.1 Gene:RNF115 / 27246 HGNCID:18154 Length:304 Species:Homo sapiens
Sequence 2:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster


Alignment Length:212 Identity:46/212 - (21%)
Similarity:68/212 - (32%) Gaps:68/212 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    88 RPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGS------SRPDRSPAIEGILQ 146
            :|....||....:...:|....|.......|..|.:|....|.||      |||:|...:|.|.:
  Fly  1100 QPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPLSLGSRILIAPSRPNRGATLETIER 1164

Human   147 HIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKITS 211
            :..            ||.:.                            ::........|.||   
  Fly  1165 NTL------------PHKYR----------------------------RVRRPSETDEDAEK--- 1186

Human   212 LPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLN--- 273
                            |.:|...:.:|.|||:|||.|.||:.|:..||..:..||:||..:.   
  Fly  1187 ----------------CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHM 1235

Human   274 GEDSTRQSQSTEASASN 290
            ..|:...|.|....|:|
  Fly  1236 PNDALPPSSSGVPDAAN 1252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF115NP_055270.1 zinc_ribbon_9 19..49 CDD:316857
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..138 12/48 (25%)
RING-H2_RNF115 226..272 CDD:319714 19/45 (42%)
RING-H2 finger (C3H2C3-type) 228..268 CDD:319714 17/39 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..304 5/22 (23%)
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 19/61 (31%)
zf-RING_2 1187..1228 CDD:290367 17/40 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.