DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF115 and gzl

DIOPT Version :10

Sequence 1:NP_055270.1 Gene:RNF115 / 27246 HGNCID:18154 Length:304 Species:Homo sapiens
Sequence 2:NP_649653.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster


Alignment Length:92 Identity:29/92 - (31%)
Similarity:50/92 - (54%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


Human   206 KEKITSLPTVTVTQEQVDMGLE-CPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWL-ELHDTCPVC 268
            |..:..||.:..|:...:...: |.:|.||:..::::|.|||:|.:|:.||.||| |....||:|
  Fly   212 KSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPIC 276

Human   269 RKSLNGEDSTRQSQSTEASASNRFSND 295
            ::.:..:...|.|:|.:.|..|....|
  Fly   277 KRKVFTKGEARASRSRQPSLDNVTDTD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF115NP_055270.1 zinc_ribbon_9 19..49 CDD:433910
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..138
RING-H2_RNF115 226..275 CDD:438452 19/50 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..304 6/24 (25%)
gzlNP_649653.1 PA_C_RZF_like 14..171 CDD:239038
RING-H2_RNF13-like 233..278 CDD:438327 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.