DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF115 and CG4325

DIOPT Version :10

Sequence 1:NP_055270.1 Gene:RNF115 / 27246 HGNCID:18154 Length:304 Species:Homo sapiens
Sequence 2:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster


Alignment Length:99 Identity:24/99 - (24%)
Similarity:39/99 - (39%) Gaps:26/99 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   228 CPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRK---------------------- 270
            |.:|.|.:...:.::...|.|.||..|:..|.:...|||:||.                      
  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYFQLYLDFEEFPESASAQ 72

Human   271 --SLNGEDSTR--QSQSTEASASNRFSNDSQLHD 300
              |..|.:.::  .|.|:..|::|..|||:...|
  Fly    73 GGSWGGHNRSQGHSSSSSSCSSNNNNSNDNSSSD 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF115NP_055270.1 zinc_ribbon_9 19..49 CDD:433910
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..138
RING-H2_RNF115 226..275 CDD:438452 15/70 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..304 9/31 (29%)
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.