DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERP1 and CG32276

DIOPT Version :10

Sequence 1:NP_055260.1 Gene:SERP1 / 27230 HGNCID:10759 Length:66 Species:Homo sapiens
Sequence 2:NP_728830.1 Gene:CG32276 / 251645 FlyBaseID:FBgn0047135 Length:64 Species:Drosophila melanogaster


Alignment Length:63 Identity:43/63 - (68%)
Similarity:50/63 - (79%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIR 63
            |...||:|:||||.||.:|.||||.|:|: ..|.:..|||||||||||||||||||||:||||
  Fly     1 MAPPQRMRVANEKASKYVTMRGNVPKSSK-TKEGQYPVGPWLLALFIFVVCGSAIFQIVQSIR 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERP1NP_055260.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 17/29 (59%)
RAMP4 3..59 CDD:461965 37/55 (67%)
CG32276NP_728830.1 RAMP4 2..58 CDD:461965 37/56 (66%)

Return to query results.
Submit another query.