DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR82 and AstC-R1

DIOPT Version :9

Sequence 1:NP_543007.1 Gene:GPR82 / 27197 HGNCID:4533 Length:336 Species:Homo sapiens
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:339 Identity:82/339 - (24%)
Similarity:150/339 - (44%) Gaps:64/339 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    20 IIYILLCIVGVFGNTLSQWIFLTKIGKKTSTHIYLSHLVTANLLVCSAMPFMSIYFLKGFQWEYQ 84
            ::|..:||:|:|||||..::.|.....:|.|:||:.:|..|:......:||: :|.::...|.:.
  Fly    82 VLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFL-LYTMRICSWRFG 145

Human    85 SAQCRVVNFLGTLSMHASMFVSLLILSWIAISRYATLMQKDSSQETTSCYEKIFYGHLLKKFRQP 149
            ...|:..    .:|...:.|.|.:.|..::..||..:....||                .::|..
  Fly   146 EFMCKAY----MVSTSITSFTSSIFLLIMSADRYIAVCHPISS----------------PRYRTL 190

Human   150 NFARKLCIYIWGVVLGIIIPVTVYYSVIEATEGEESLC-------YNRQMELGAMISQIAGLIGT 207
            :.|:.:....|.....:::||.:|.|.:|..:|....|       |.:..             ||
  Fly   191 HIAKVVSAIAWSTSAVLMLPVILYASTVEQEDGINYSCNIMWPDAYKKHS-------------GT 242

Human   208 TFIGFSFLV--------VLTSYYSFVSHLRKI--RTCTSIMEKDLTYSSVKRHLLVIQILLIVCF 262
            |||.::|.:        :|:.||..:..||.:  :..|...||...:..|.|.:|.:..:.|:|:
  Fly   243 TFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCW 307

Human   263 LPYSIFKPIFYVLH----QRDNCQQLNYLIETKNILTCLASARSSTDPIIFLLLDKTFKKTLYNL 323
            ||:.|.:  ..::|    ||| ..:|..||..  :|..|..:.|:.:||::..|.:.|:|:.:..
  Fly   308 LPHWISQ--VALIHSNPAQRD-LSRLEILIFL--LLGALVYSNSAVNPILYAFLSENFRKSFFKA 367

Human   324 FTKSN----SAHMQ 333
            ||..|    :|.:|
  Fly   368 FTCMNKQDINAQLQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR82NP_543007.1 7tm_1 32..308 CDD:278431 68/296 (23%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 76/318 (24%)
7tm_1 94..353 CDD:278431 69/297 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.