DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC8 and si:ch73-380l3.2

DIOPT Version :9

Sequence 1:NP_055257.2 Gene:SIGLEC8 / 27181 HGNCID:10877 Length:499 Species:Homo sapiens
Sequence 2:NP_001348166.1 Gene:si:ch73-380l3.2 / 100003913 ZFINID:ZDB-GENE-080303-1 Length:266 Species:Danio rerio


Alignment Length:223 Identity:57/223 - (25%)
Similarity:93/223 - (41%) Gaps:35/223 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    25 DGYLLQVQELVTVQEGLCVHVPCSFSYP-QDGWTDSDPVHGYWFRA---------GDRPYQDAPV 79
            |.:.:.|:..:......||.:||:|:|| ......|..:.|.|.:.         ||:..     
Zfish    22 DVWKVDVEHKMKALVSSCVVLPCNFTYPVHQQQQPSYRIRGIWHKMNKWDDIIFYGDKTL----- 81

Human    80 ATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTK 144
                    |:...:||.:|:|.:.|.:|||.|.:.:..|.|.|.||:|   ::.:.|.:.::...
Zfish    82 --------VEDNFKGRTRLIGSLGSFNCSLEIDEVKNTDNGPYCFRVE---LETAPKDKYSFVDN 135

Human   145 QLSVFVTALTHRPDILILGTLESGHSRNLTCSVPWACKQGTPPMISW--IGASVSS-----PGPT 202
            .:|:.......:|.:....::..|......|||...|.. ..|..||  .|..:||     .|..
Zfish   136 CVSITTIEEAPKPMLEAETSVLEGEPAIFKCSVRHTCPT-YQPSFSWNRAGKIISSYNDLGHGNW 199

Human   203 TARSSVLTLTPKPQDHGTSLTCQVTLPG 230
            .| .|:||.||..:|:.||:.|.|...|
Zfish   200 EA-ESLLTFTPTKEDNYTSIECTVKYHG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC8NP_055257.2 Ig 27..151 CDD:299845 31/133 (23%)
Carbohydrate binding. /evidence=ECO:0000269|PubMed:27357658, ECO:0007744|PDB:2N7B 72..75 0/2 (0%)
Carbohydrate binding. /evidence=ECO:0000269|PubMed:27357658, ECO:0007744|PDB:2N7B 134..138 1/3 (33%)
Ig 171..229 CDD:299845 22/64 (34%)
IG_like 269..344 CDD:214653
IGc2 275..335 CDD:197706
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 410..443
ITIM motif 445..450
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..470
SLAM-like motif 468..473
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 478..499
si:ch73-380l3.2NP_001348166.1 Ig 24..141 CDD:325142 31/132 (23%)
Ig 148..226 CDD:325142 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I12412
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12035
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.