DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUBG2 and betaTub85D

DIOPT Version :9

Sequence 1:XP_024306462.1 Gene:TUBG2 / 27175 HGNCID:12419 Length:596 Species:Homo sapiens
Sequence 2:NP_524290.2 Gene:betaTub85D / 41124 FlyBaseID:FBgn0003889 Length:446 Species:Drosophila melanogaster


Alignment Length:299 Identity:116/299 - (38%)
Similarity:184/299 - (61%) Gaps:16/299 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     3 REIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLL 67
            |||:.:|.||||||||.:||:.:..||.|...|.....:....:|.:|::.:|....|:|||:|:
  Fly     2 REIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQLERINVYYNEATGAKYVPRAILV 66

Human    68 DLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG-FSQGEKIHEDIFDIIDREADGSDS 131
            ||||..:.|:.:..:.:::.|:|....:  .|||||||.| :::|.::.:.:.|::.:|::|.|.
  Fly    67 DLEPGTMDSVRSGAFGQIFRPDNFVFGQ--SGAGNNWAKGHYTEGAELVDSVLDVVRKESEGCDC 129

Human   132 LELQNSSRVIKGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPYN 196
            |:         ||.|.||:.||||||:|:.|:.::.:.||.:::.|:||.| ..::||.||:|||
  Fly   130 LQ---------GFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVP-SPKVSDTVVEPYN 184

Human   197 SLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNND 261
            :.|::.:|.:|.|....:||.||..|....|.:..|::..:|.|||..||..||.||:||.:|.|
  Fly   185 ATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNAD 249

Human   262 LIGLIASLIPTPRLHFLMTGYTPLTT--DQSVRAAFSVP 298
            |..|..:::|.|||||.|.|:.|||:  .|..| |.:||
  Fly   250 LRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR-ALTVP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUBG2XP_024306462.1 gamma_tubulin 3..>293 CDD:276957 112/292 (38%)
INTAP 306..>379 CDD:318758
betaTub85DNP_524290.2 PLN00220 1..430 CDD:215107 116/299 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.