DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUBG2 and betaTub56D

DIOPT Version :9

Sequence 1:XP_024306462.1 Gene:TUBG2 / 27175 HGNCID:12419 Length:596 Species:Homo sapiens
Sequence 2:NP_725896.1 Gene:betaTub56D / 37238 FlyBaseID:FBgn0284243 Length:456 Species:Drosophila melanogaster


Alignment Length:281 Identity:108/281 - (38%)
Similarity:170/281 - (60%) Gaps:16/281 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    21 FWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKL 85
            ||:.:..||||...|.....:....:|.:|::.:|....|:|||||:||||..:.|:.:.|:.::
  Fly    29 FWEIISDEHGIDATGAYHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQI 93

Human    86 YNPENIYLSEHGGGAGNNWASG-FSQGEKIHEDIFDIIDREADGSDSLELQNSSRVIKGFVLCHS 149
            :.|:|....:  .|||||||.| :::|.::.:.:.|::.:||:..|.|:         ||.|.||
  Fly    94 FRPDNFVFGQ--SGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQ---------GFQLTHS 147

Human   150 IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPYNSLLTLKRLTQNADCVVVL 214
            :.||||||:|:.|:.::.:.||.:::.||||.| ..::||.||:|||:.|::.:|.:|.|....:
  Fly   148 LGGGTGSGMGTLLISKIREEYPDRIMNTYSVVP-SPKVSDTVVEPYNATLSVHQLVENTDETYCI 211

Human   215 DNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLM 279
            ||.||..|....|.:..|::..:|.|||..||..||.||:||.:|.||..|..:::|.|||||.|
  Fly   212 DNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFM 276

Human   280 TGYTPLTT--DQSVRAAFSVP 298
            .|:.|||:  .|..| |.:||
  Fly   277 PGFAPLTSRGSQQYR-ALTVP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUBG2XP_024306462.1 gamma_tubulin 3..>293 CDD:276957 104/274 (38%)
INTAP 306..>379 CDD:318758
betaTub56DNP_725896.1 beta_tubulin 26..435 CDD:276956 108/281 (38%)
PLN00220 29..438 CDD:215107 108/281 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.