DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUBG2 and gammaTub23C

DIOPT Version :9

Sequence 1:XP_024306462.1 Gene:TUBG2 / 27175 HGNCID:12419 Length:596 Species:Homo sapiens
Sequence 2:NP_476804.1 Gene:gammaTub23C / 33501 FlyBaseID:FBgn0260639 Length:475 Species:Drosophila melanogaster


Alignment Length:291 Identity:232/291 - (79%)
Similarity:261/291 - (89%) Gaps:9/291 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAV 65
            ||.||||||||||||||||||||:||.||||||.|::|:||.:|.||||||||||||:|||||||
  Fly     1 MPSEIITLQLGQCGNQIGFEFWKRLCLEHGISPSGVLEDFANDGLDRKDVFFYQADDDHYIPRAV 65

Human    66 LLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSD 130
            |||||||||::|:.|.|:|||||||:|||:||||||||||||:|||||:.|::||||||||||||
  Fly    66 LLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNWASGYSQGEKLQEEVFDIIDREADGSD 130

Human   131 SLELQNSSRVIKGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPY 195
            |||         ||:||||||||||||:||:::|||.|||||||:||:||||.|||:||||||||
  Fly   131 SLE---------GFILCHSIAGGTGSGMGSFIMERLADRYPKKLIQTFSVFPNQDEISDVVVQPY 186

Human   196 NSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNN 260
            ||:|||||||..||.|||||||||||||.||||||||||||||.|||||||.||||||||.||||
  Fly   187 NSMLTLKRLTTAADSVVVLDNTALNRIACDRLHIQNPSFSQINNLVSTIMSVSTTTLRYPSYMNN 251

Human   261 DLIGLIASLIPTPRLHFLMTGYTPLTTDQSV 291
            :||||.|.|||||:||||||||||||:|..:
  Fly   252 NLIGLTAPLIPTPQLHFLMTGYTPLTSDSDI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUBG2XP_024306462.1 gamma_tubulin 3..>293 CDD:276957 230/289 (80%)
INTAP 306..>379 CDD:318758
gammaTub23CNP_476804.1 PLN00222 1..451 CDD:215108 232/291 (80%)
gamma_tubulin 4..440 CDD:276957 230/288 (80%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 381 1.000 Domainoid score I843
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69216
Inparanoid 1 1.050 739 1.000 Inparanoid score I596
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53966
OrthoDB 1 1.010 - - D267298at33208
OrthoFinder 1 1.000 - - FOG0002428
OrthoInspector 1 1.000 - - mtm8608
orthoMCL 1 0.900 - - OOG6_101897
Panther 1 1.100 - - O PTHR11588
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1481
SonicParanoid 1 1.000 - - X1612
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.