DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUBG2 and CG32396

DIOPT Version :9

Sequence 1:XP_024306462.1 Gene:TUBG2 / 27175 HGNCID:12419 Length:596 Species:Homo sapiens
Sequence 2:NP_729172.1 Gene:CG32396 / 117406 FlyBaseID:FBgn0052396 Length:462 Species:Drosophila melanogaster


Alignment Length:294 Identity:111/294 - (37%)
Similarity:158/294 - (53%) Gaps:30/294 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     3 REIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFAT---EGT-----DRKDVFFYQADDEH 59
            |||:|||:|..||.||..||..:..|||:       ::|:   .||     :|.:|||.....:.
  Fly     2 REIVTLQIGGAGNAIGDSFWHVISHEHGV-------DYASGRFGGTSPLQLERINVFFNATASKR 59

Human    60 YIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGF-SQGEKIHEDIFDIID 123
            :..|.:|:|.|...|..:..|  ::||.|||......  .||||:|.|: :.|..|.:.:.:...
  Fly    60 FYARTILIDTEASTIQRLNAS--SQLYRPENFVAGSE--SAGNNFARGYHTDGAAILDQVLENTR 120

Human   124 READGSDSLELQNSSRVIKGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMS 188
            ||.:..|||:         ||.|.|||.|||||||.|.::|.|.::||..|:..|...| ...||
  Fly   121 REVESVDSLQ---------GFQLLHSIGGGTGSGLTSLIMEALVEQYPDNLLCNYVTIP-SPNMS 175

Human   189 DVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLR 253
            .|||:|||:||:...|..|:.....|||.||.:|....|.::...:..||.:|:..||..||.||
  Fly   176 QVVVEPYNALLSTPALVNNSHLTFCLDNEALFQICNRNLKLKMSGYEHINHIVALTMSGITTCLR 240

Human   254 YPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTT 287
            :||.:|..|..:..:::|.||||||:.|:.||.|
  Fly   241 FPGQLNAGLRKIYVNMVPFPRLHFLIPGFAPLVT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUBG2XP_024306462.1 gamma_tubulin 3..>293 CDD:276957 111/294 (38%)
INTAP 306..>379 CDD:318758
CG32396NP_729172.1 PTZ00010 1..421 CDD:240228 111/294 (38%)
beta_tubulin 2..425 CDD:276956 111/294 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.