DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHIA and Cht2

DIOPT Version :9

Sequence 1:NP_970615.2 Gene:CHIA / 27159 HGNCID:17432 Length:476 Species:Homo sapiens
Sequence 2:NP_001246550.1 Gene:Cht2 / 38223 FlyBaseID:FBgn0022702 Length:484 Species:Drosophila melanogaster


Alignment Length:449 Identity:156/449 - (34%)
Similarity:226/449 - (50%) Gaps:56/449 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    24 LTCYFTNWAQYRPGLGRFMPDNIDPCLCTHLIYAFAGRQNNE--ITTIE-WNDVTL------YQA 79
            :.||.:.||.|||..|.:..:|.||.||||::|||||....:  |.::: |.|:..      |:.
  Fly    43 VVCYVSTWAVYRPEQGAYAIENFDPNLCTHVVYAFAGLDITQAAIKSLDPWQDLKEEYGKGGYEK 107

Human    80 FNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGS 144
            ..|||..:..||..|||||||.|:|.::.:|:....|..|:..|..|:|:|.|||||.|||||..
  Fly   108 MTGLKRSHPHLKVSLAIGGWNEGSANYSTLVANNLLRGRFVKQVSSFIRKYNFDGLDLDWEYPTQ 172

Human   145 RGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHV 209
            |...|.|:..|.:|.:|:||.|::..       |::|:|:.|....|...|::.|:|:||||:|:
  Fly   173 RKGKPADRENFVLLTKELREEFDEHG-------LLLTSAIGASKKVIDEAYDVRQISRYLDYLHI 230

Human   210 MTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILS 274
            |.||.||||:...|.|:|| ..|.|...:...::||::..    |||.|||::|.|.||..|  .
  Fly   231 MCYDYHGSWDRRVGYNAPL-TAPADDPLSVKFSIDYLLKL----GAPPEKLVMGLPFYGRTF--K 288

Human   275 NPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKN---GATQGWDAPQ--EVPYAYQGNVW- 333
            ..::..:...:.|.|..|||.:|.|...|.|||..|.|   |.|:.|| ||  :|....:.||: 
  Fly   289 TLASGFLNDVSEGVGFKGPYTREDGFLGYNEICQTLSNQTSGWTREWD-PQTSQVLAKSERNVFT 352

Human   334 -----VGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFC-------------------NQ 374
                 |.||:.:|...|..:....:..|.|||::|.|||.|. |                   :.
  Fly   353 QEINVVTYDSSRSIANKVLFAMSKRLAGVMVWSVDTDDFLGN-CKLDEDTYEDFQKVTAAPKRSS 416

Human   375 GKFPLISTLKKALGLQSASCTAP-AQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAV 432
            ..:||:.|:.:|..|.......| .||.:.....|.||.....::.:...|.|.|..||
  Fly   417 QNYPLLRTINEATMLAVDELAVPEPQPDDSENEIPHGSIADRKNAGASMVSLGLGVTAV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHIANP_970615.2 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 143/401 (36%)
Glyco_18 26..365 CDD:214753 135/358 (38%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 70..71 0/1 (0%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 97..100 2/2 (100%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 210..213 1/2 (50%)
ChtBD2 429..476 CDD:214696 2/4 (50%)
Cht2NP_001246550.1 Glyco_18 42..389 CDD:214753 135/360 (38%)
GH18_chitolectin_chitotriosidase 43..428 CDD:119351 143/400 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.