DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHIA and Cht9

DIOPT Version :9

Sequence 1:NP_970615.2 Gene:CHIA / 27159 HGNCID:17432 Length:476 Species:Homo sapiens
Sequence 2:NP_611543.3 Gene:Cht9 / 37392 FlyBaseID:FBgn0034582 Length:368 Species:Drosophila melanogaster


Alignment Length:392 Identity:152/392 - (38%)
Similarity:213/392 - (54%) Gaps:31/392 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTKLILLTGLVLILNLQLGSAYQLTCYFTNWAQYRPGLGRFMPDNIDPCLCTHLIYAFAG-RQNN 64
            |.||:.|.. ||.|:..:|:...:.||:..||.||.|.|:|...|||..|||||.|:|.| ..|.
  Fly     1 MGKLLALLA-VLCLSQVIGAERIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGINDNG 64

Human    65 EITTIE-WNDVTL---YQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIK 125
            ||.::: |.|..|   .||.: |||:||.||.|..:||||.|:..:::|......||.||.|.:.
  Fly    65 EIQSLDTWLDYDLGFINQAIS-LKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALN 128

Human   126 FLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISN 190
            .||.:.|||||.|||||..||....|:..|..|::|::|||.....::.       .||.||.|.
  Fly   129 LLRNHGFDGLDLDWEYPNQRGGNWNDRANFVTLLREIKEAFAPYGYELG-------IAVGAGESL 186

Human   191 IQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGA 255
            ..:.|||..::|.:|:|:|||||...:.:|.||.|:|.:.            |:..:|:|...||
  Fly   187 ASASYEIANIAQQVDFINVMTYDFAMASDGQTGFNAPQWA------------VENAINFWLSQGA 239

Human   256 PAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDA 320
            ||.||::|..|||.:|.||:.|....|||..|.|.||.|...:|...|.|||   :|.....:|.
  Fly   240 PANKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSYTGSTGYLGYNEIC---QNNWHTVFDY 301

Human   321 PQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKK 385
            ....||||.|:.||.:||:.|...|..:.......|||:|:::.||:.|. |.: .:||:.|:.:
  Fly   302 DNAAPYAYSGDQWVSFDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQ-CGE-TYPLLKTINR 364

Human   386 AL 387
            .|
  Fly   365 KL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHIANP_970615.2 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 143/367 (39%)
Glyco_18 26..365 CDD:214753 136/343 (40%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 70..71 0/1 (0%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 97..100 2/2 (100%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 210..213 2/2 (100%)
ChtBD2 429..476 CDD:214696
Cht9NP_611543.3 GH18_chitolectin_chitotriosidase 23..366 CDD:119351 143/367 (39%)
Glyco_18 23..346 CDD:214753 136/345 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.