DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHIA and Idgf5

DIOPT Version :9

Sequence 1:NP_970615.2 Gene:CHIA / 27159 HGNCID:17432 Length:476 Species:Homo sapiens
Sequence 2:NP_611321.3 Gene:Idgf5 / 37104 FlyBaseID:FBgn0064237 Length:444 Species:Drosophila melanogaster


Alignment Length:451 Identity:111/451 - (24%)
Similarity:192/451 - (42%) Gaps:92/451 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     5 ILLTGLVLILNLQLGSAYQLTCYFTNWAQYRPGLGRFMPDNIDPCL--CTHLIYAFAG--RQNNE 65
            :||...:...........:|.|::...:..|.|..:.....::|.|  |..|:|.:||  ....:
  Fly    12 LLLCSFLAFFQSTYAEVGKLVCFYDAQSFVREGPAQMSLAELEPALQFCNFLVYGYAGIDAVTYK 76

Human    66 ITTIE---WNDVTLYQAFNGLKNKNSQLKTLLAIGG----WNFGTA---PFTAMVSTPENRQTFI 120
            |.:::   .||...|:....|:.|...::.||::||    .:.|.|   .:..::...|:|::|.
  Fly    77 IKSLDPSLTNDRQHYRHITALRKKYPHVRFLLSVGGDRDVNSEGVADSDKYLRLLEQSEHRKSFQ 141

Human   121 TSVIKFLRQYEFDGLDFDWEYPGSRGSPPQD--KHLFTVL------------VQEMREAF----E 167
            .||:..|....|||:|..|::|.:|....|.  |.::..|            .:|.||.|    |
  Fly   142 ASVLAELNNNGFDGIDLAWQFPKNRPKLQQGVFKRVWGSLRGWFSSSSVDEKSEEHREQFATLLE 206

Human   168 QEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGEN------- 225
            :....:.:...::|.::...:| .:...::|::...:|::::.|||..      |.|.       
  Fly   207 ELQSDLRRGGQLLTVSMLPHVS-AELFIDVPKVLSNVDFVNLGTYDFQ------TPERDPKVADL 264

Human   226 -SPLY-KYPTDTGSNAYLNVDYVMNYWKDNGA--PAEKLIVGFPTYGHNFILSNPSNTGI-GAP- 284
             :||| .|..|...    ||.|.:.||.:..:  ...||.||..:||..:.::.  |:|| |.| 
  Fly   265 PTPLYAMYDRDPSH----NVQYQVQYWMNQTSEISVHKLHVGVTSYGRAWNMTR--NSGITGYPP 323

Human   285 ---TSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQ--EVP--------------YAY-- 328
               .:||.|.|......|:.::.|||..|:       ..||  |||              |||  
  Fly   324 IPAANGAAPPGRQTVTPGLLSWPEICDLLQ-------QQPQDREVPHLRKVGDPTKRFGIYAYRA 381

Human   329 -----QGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLK 384
                 :..:||||::..:..|||.::.....||.....:.:|||.|. |...|||::.::|
  Fly   382 ADDQGENGLWVGYEDPLTAAIKAGFVHAQGLGGVAFHDLSMDDFRGQ-CAGEKFPILRSIK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHIANP_970615.2 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 109/432 (25%)
Glyco_18 26..365 CDD:214753 99/409 (24%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 70..71 0/3 (0%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 97..100 2/6 (33%)
Chitooligosaccharide binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01258 210..213 1/2 (50%)
ChtBD2 429..476 CDD:214696
Idgf5NP_611321.3 GH18_IDGF 30..444 CDD:119352 109/433 (25%)
Glyco_18 30..423 CDD:214753 100/412 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156427
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.