DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CHIA and Muc96D

DIOPT Version :9

Sequence 1:	NP_970615.2	Gene:	CHIA / 27159	HGNCID:	17432	Length:	476	Species:	Homo sapiens
Sequence 2:	NP_733106.2	Gene:	Muc96D / 318737	FlyBaseID:	FBgn0051439	Length:	881	Species:	Drosophila melanogaster

Alignment Length:	63	Identity:	17/63 - (26%)
Similarity:	31/63 - (49%)	Gaps:	9/63 - (14%)

- Green bases have known domain annotations that are detailed below.

Human   417 SSSSGGSSGGSGFCAVRANGLYP-VANNRNAFWHCVNGVTYQQNC--------QAGLVFDTSC 470
            :|:|.|:|.....|..:|||:.. |..:.:.|:.|.|||..:..|        ::.:.::|.|
  Fly    16 ASTSSGASVSDLLCRNKANGIRALVPGSCSRFYECQNGVAKEYTCPKFYDFKIRSCVTYNTGC 78

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CHIA	NP_970615.2	GH18_chitolectin_chitotriosidase	24..387	CDD:119351
		Glyco_18	26..365	CDD:214753
		Chitooligosaccharide binding. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01258	70..71
		Chitooligosaccharide binding. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01258	97..100
		Chitooligosaccharide binding. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01258	210..213
		ChtBD2	429..476	CDD:214696	13/51 (25%)
Muc96D	NP_733106.2	ChtBD2	29..72	CDD:214696	11/42 (26%)
Muc96D	NP_733106.2	CBM_14	827..875	CDD:279884
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG3325
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900