powered by:
Protein Alignment CHIA and Muc96D
DIOPT Version :9
Sequence 1: | NP_970615.2 |
Gene: | CHIA / 27159 |
HGNCID: | 17432 |
Length: | 476 |
Species: | Homo sapiens |
Sequence 2: | NP_733106.2 |
Gene: | Muc96D / 318737 |
FlyBaseID: | FBgn0051439 |
Length: | 881 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 17/63 - (26%) |
Similarity: | 31/63 - (49%) |
Gaps: | 9/63 - (14%) |
- Green bases have known domain annotations that are detailed below.
Human 417 SSSSGGSSGGSGFCAVRANGLYP-VANNRNAFWHCVNGVTYQQNC--------QAGLVFDTSC 470
:|:|.|:|.....|..:|||:.. |..:.:.|:.|.|||..:..| ::.:.::|.|
Fly 16 ASTSSGASVSDLLCRNKANGIRALVPGSCSRFYECQNGVAKEYTCPKFYDFKIRSCVTYNTGC 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3325 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.