DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB7 and Hsp27

DIOPT Version :9

Sequence 1:NP_001336611.1 Gene:HSPB7 / 27129 HGNCID:5249 Length:245 Species:Homo sapiens
Sequence 2:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster


Alignment Length:210 Identity:49/210 - (23%)
Similarity:72/210 - (34%) Gaps:66/210 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    47 WGHL---DWVWAHVSRSSQRGLPGGGGIGA-DLGRKGRIWRGQQRPLTATWAEQRAWPPLRMAST 107
            ||||   |:               |.|:.| ||....|                     |.:.:|
  Fly    21 WGHLLEDDF---------------GFGVHAHDLFHPRR---------------------LLLPNT 49

Human   108 LAQGKDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPGGAGN--IKTLG-DAYEFAVDVRDFSPE 169
            |..|:            ..:..:.|.|........|..|..|  :..:| |.::..:||..|.|.
  Fly    50 LGLGR------------RRYSPYERSHGHHNQMSRRASGGPNALLPAVGKDGFQVCMDVSQFKPN 102

Human   170 DIIVTTSNNHIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPH 231
            ::.|...:|.:.|..   |:....|.:...|..|..||:..||..|.|.:..||.||::|...|.
  Fly   103 ELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPS 167

Human   232 TE--------HVQQT 238
            .|        .:|||
  Fly   168 KEQAKSERIVQIQQT 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB7NP_001336611.1 ACD_HspB7_like 148..228 CDD:107234 25/85 (29%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.