Sequence 1: | NP_001336611.1 | Gene: | HSPB7 / 27129 | HGNCID: | 5249 | Length: | 245 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287001.1 | Gene: | Hsp27 / 39078 | FlyBaseID: | FBgn0001226 | Length: | 213 | Species: | Drosophila melanogaster |
Alignment Length: | 210 | Identity: | 49/210 - (23%) |
---|---|---|---|
Similarity: | 72/210 - (34%) | Gaps: | 66/210 - (31%) |
- Green bases have known domain annotations that are detailed below.
Human 47 WGHL---DWVWAHVSRSSQRGLPGGGGIGA-DLGRKGRIWRGQQRPLTATWAEQRAWPPLRMAST 107
Human 108 LAQGKDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPGGAGN--IKTLG-DAYEFAVDVRDFSPE 169
Human 170 DIIVTTSNNHIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPH 231
Human 232 TE--------HVQQT 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HSPB7 | NP_001336611.1 | ACD_HspB7_like | 148..228 | CDD:107234 | 25/85 (29%) |
Hsp27 | NP_001287001.1 | metazoan_ACD | 86..163 | CDD:107247 | 23/76 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |