DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB7 and Hsp67Bc

DIOPT Version :10

Sequence 1:NP_001336611.1 Gene:HSPB7 / 27129 HGNCID:5249 Length:245 Species:Homo sapiens
Sequence 2:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster


Alignment Length:104 Identity:23/104 - (22%)
Similarity:36/104 - (34%) Gaps:41/104 - (39%)


- Green bases have known domain annotations that are detailed below.


Human   350 EWEAPQIANPKCESAPGCG--VWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDL 412
            :|.:.|::   ..||...|  :|    |.:|...|    ..|||..                 ||
  Fly   135 KWRSRQLS---FSSAKWYGDVIW----IFDPGIIG----AQIDNEG-----------------DL 171

Human   413 EP-FKMTPFSAIG----LELW------SMTSDIFFDNFI 440
            :. |..|.|.:.|    :.:|      |:...|:.|.|:
  Fly   172 KKCFIQTLFHSTGSRQSIRIWWREIMLSLILRIYLDKFL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB7NP_001336611.1 ACD_HspB7_like 148..228 CDD:107234
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.