DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYTH4 and SPBC211.03c

DIOPT Version :9

Sequence 1:NP_037517.1 Gene:CYTH4 / 27128 HGNCID:9505 Length:394 Species:Homo sapiens
Sequence 2:NP_596613.1 Gene:SPBC211.03c / 2540746 PomBaseID:SPBC211.03c Length:1462 Species:Schizosaccharomyces pombe


Alignment Length:281 Identity:82/281 - (29%)
Similarity:131/281 - (46%) Gaps:42/281 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    37 KDEIADVFAQIDCFESAEESRMAQKEKELCI-GRKKFNMDPAKGIQYFIEHKLL--TPDVQDIAR 98
            ||::|....:            ::|.|.:.| |.:.||..|:.||.:..:|.::  :.:...|..
pombe   535 KDDVAKTLIE------------SKKRKAIIIEGAELFNESPSDGIAFLTQHSIIKQSDNPTCIVE 587

Human    99 FLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRM 163
            |.:....|:|..:|.:|.:..  |..:|.||:...:|....:.:|||..|.|||||||:|.|:|:
pombe   588 FFHSTNRLSKRVLGEFLTKGS--NSHILNAFISAFDFKGKRIDEALRLLLQSFRLPGESQLIERV 650

Human   164 MEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRD--RPPFERFVSMNRGINNGSDL 226
            :|.|:..|...||....|.|..:|||:|||||||..||||::.  |...:.|....||:|:|.|.
pombe   651 LETFSHYYMSANPDSMSSKDAAFVLSYSIIMLNTDQHNPNIKSQRRMTLDDFCRNVRGVNDGQDF 715

Human   227 PEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVK---TWKRR--------- 279
            ..:.|..::.:||.....:.|:...:|:..:.      | .||...||   .:||.         
pombe   716 DRNFLSEIYKAIKENEIIVAEEHDTELSFLYI------W-SKLQQSVKITEPFKRSSSNVHDKIV 773

Human   280 ----WFILTDNCLYYFEFTTD 296
                |..:....:|.|...|:
pombe   774 FLEVWKSIMAALIYVFSTATE 794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYTH4NP_037517.1 Sec7 61..243 CDD:279680 66/186 (35%)
PH_GRP1-like 258..376 CDD:269954 11/55 (20%)
PH 262..374 CDD:278594 11/51 (22%)
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250 268..275 4/9 (44%)
C-terminal autoinhibitory region. /evidence=ECO:0000250 386..394
SPBC211.03cNP_596613.1 Sec7_N 287..475 CDD:289549
COG5307 289..1303 CDD:227623 82/281 (29%)
Sec7 548..732 CDD:279680 65/185 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10663
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.