DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DKK2 and NimC3

DIOPT Version :9

Sequence 1:NP_055236.1 Gene:DKK2 / 27123 HGNCID:2892 Length:259 Species:Homo sapiens
Sequence 2:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster


Alignment Length:255 Identity:52/255 - (20%)
Similarity:81/255 - (31%) Gaps:99/255 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    14 LLLLAAVLMVESSQIGSSRA---KLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQA 75
            :|:|..:.:||.|.:..:..   |..|:|.    :.| .|..|.||                  |
  Fly    11 VLVLMTIHLVEVSSLAITNGHCQKNISVKY----QVP-VAKTRMAG------------------A 52

Human    76 YPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTR-CNNGICIPVTESILTPHI 139
            .|.::....::..|            |...::.|.....:|||..| ...|.|.||.:..    .
  Fly    53 GPPNASHPIDLDSY------------VVYEERVRWDNIQVCCPGYRTILFGFCEPVCQEA----C 101

Human   140 PALDGTRHRDRNH---GHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWT 201
            ||.......||.|   |:..:|              .|..||:                      
  Fly   102 PAHSYCAEPDRCHCQRGYEPSH--------------HHTTGHQ---------------------- 130

Human   202 KICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDAT--YSSKARLHVCQKI 259
            .||:||...|  |.:.....:|     ..|:|..|     :|||:  :|...|   |:::
  Fly   131 LICRPVCQGG--CPEHSHCVAH-----NECECWPG-----FKDASSWFSLSLR---CERV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DKK2NP_055236.1 Dickkopf_N 78..128 CDD:282549 8/50 (16%)
DKK-type Cys-1 78..127 8/49 (16%)
DKK-type Cys-2 183..256 15/74 (20%)
NimC3NP_524928.2 MSC 85..>212 CDD:286487 31/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.