DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DKK2 and drpr

DIOPT Version :9

Sequence 1:NP_055236.1 Gene:DKK2 / 27123 HGNCID:2892 Length:259 Species:Homo sapiens
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:266 Identity:61/266 - (22%)
Similarity:83/266 - (31%) Gaps:103/266 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    67 KKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACM--------VCRRK----------KKRC--- 110
            |.|....|..||.:|.:|:       |..|  |||        ||..|          ::.|   
  Fly   222 KHGAQCQQDCPCQNDGKCQ-------PETG--ACMCNPGWTGDVCANKCPVGSYGPGCQESCECY 277

Human   111 ------HRDGMC-CP---------------------STRCN----------NGICI--------P 129
                  |..|.| ||                     |..|:          ||.||        .
  Fly   278 KGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAK 342

Human   130 VTESILTPHIPALDGTR-------HRDRNHGHYSN--HDLGWQN--LGRPHTKMSHIKGHEGDPC 183
            ..|.|...:...||..|       |.|..|....|  ..:||.:  ..||.|.:.:     |..|
  Fly   343 CAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRY-----GPNC 402

Human   184 LRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKV------- 241
            ..:.:|..|..|:....|.:|.|. .:|..|.:..:.|:.|.:...||||..|..|:.       
  Fly   403 ELTCNCKNGAKCSPVNGTCLCAPG-WRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLC 466

Human   242 ---WKD 244
               ||:
  Fly   467 TAGWKN 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DKK2NP_055236.1 Dickkopf_N 78..128 CDD:282549 21/108 (19%)
DKK-type Cys-1 78..127 21/107 (20%)
DKK-type Cys-2 183..256 19/72 (26%)
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 8/44 (18%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.