DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GK and Rpt6R

DIOPT Version :9

Sequence 1:XP_011543793.1 Gene:GK / 2710 HGNCID:4289 Length:587 Species:Homo sapiens
Sequence 2:NP_651811.1 Gene:Rpt6R / 43635 FlyBaseID:FBgn0039788 Length:399 Species:Drosophila melanogaster


Alignment Length:381 Identity:81/381 - (21%)
Similarity:121/381 - (31%) Gaps:134/381 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   218 VNGGVHCTDVTNASRTML----FNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKISHSVK 278
            |:..::..|||.:||..|    :.:|                :||||           |:...|.
  Fly    93 VDKTINIKDVTPSSRVALRNESYTLH----------------KILPN-----------KVDPLVS 130

Human   279 AGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLG 343
            ...:|.||      |.:..:||.:..||.:.|..      :.....|..:|.          .||
  Fly   131 LMLVEKVP------DSTYEMVGGLDKQIQEIKEV------IELPVKHPELFD----------ALG 173

Human   344 RDKPVYYAL-----EGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYA 403
            ..:|....|     .|...:|.||..........:..||.::|...|........||.|..  :|
  Fly   174 ITQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARE--HA 236

Human   404 PYWEPSARGIICGLTQFTNKC-HIAFAALEAVCFQT---REILDAMNRDCGIPLSHLQVDGG--- 461
            |       .||     |.::. .|..|.||.....:   |.:|:.:|          |:||.   
  Fly   237 P-------SII-----FMDEIDSIGSARLETGTGDSEVQRTMLELLN----------QLDGFEAT 279

Human   462 ------MTSNKILMQLQA----------------------DILYIPVVKPSM----------PET 488
                  |.:|:|.:..||                      |||.|...|.::          .|.
  Fly   280 KNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAEEM 344

Human   489 TALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFE---PQINAEESEIRYST---WK 538
            .....|...|.....|:::|. |....||.|.||   .::..::||...|.   ||
  Fly   345 PGASGAEVKGVCTEAGMYALR-ERRVHVTQEDFEMAVSKVMMKDSEKNMSIRKFWK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GKXP_011543793.1 FGGY_GK1-3_metazoa 11..547 CDD:212664 81/381 (21%)
Rpt6RNP_651811.1 RPT1 3..396 CDD:224143 79/376 (21%)
AAA 180..311 CDD:278434 32/154 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.