DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GK and Rpt2

DIOPT Version :9

Sequence 1:XP_011543793.1 Gene:GK / 2710 HGNCID:4289 Length:587 Species:Homo sapiens
Sequence 2:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster


Alignment Length:298 Identity:52/298 - (17%)
Similarity:97/298 - (32%) Gaps:104/298 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    54 EQDPKEILHSVYECIEKTCEKLGQLNIDISNIK-------------------------------- 86
            :.||...:..:.:..::|...:|.|:..|..||                                
  Fly   165 DTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGT 229

Human    87 -----AIGVSNQRETTVVWDKITGEPLYNAVAAPVSPGPSVPVAVVPSGSSVPAPGTSSVWLDLR 146
                 |..|:||...|.:  ::.|..|   :...:..||.: |..:...:...||  |.|::|  
  Fly   230 GKTLLAKAVANQTSATFL--RVVGSEL---IQKYLGDGPKL-VRELFRVAEEHAP--SIVFID-- 284

Human   147 TQSTVESL-SKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWL 210
               .:::: :||...|:.                        ..|::|:.:.|   |...:|.: 
  Fly   285 ---EIDAVGTKRYDSNSG------------------------GEREIQRTMLE---LLNQLDGF- 318

Human   211 IWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEI---LPNVRSSSEIYGLMK 272
                  ...|.|.....||...|:         |..|.....|..:|   ||:.::...|:.:  
  Fly   319 ------DSRGDVKVIMATNRIETL---------DPALIRPGRIDRKIEFPLPDEKTKRRIFTI-- 366

Human   273 ISHSVKAGALEGVPISGCL---GDQSAALVGQMCFQIG 307
              |:.:....|.|.:|..:   .|.|.|.:..:|.:.|
  Fly   367 --HTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAG 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GKXP_011543793.1 FGGY_GK1-3_metazoa 11..547 CDD:212664 52/298 (17%)
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 52/298 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.