DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GK and kat-60L1

DIOPT Version :9

Sequence 1:XP_011543793.1 Gene:GK / 2710 HGNCID:4289 Length:587 Species:Homo sapiens
Sequence 2:NP_001163523.1 Gene:kat-60L1 / 40715 FlyBaseID:FBgn0037375 Length:673 Species:Drosophila melanogaster


Alignment Length:221 Identity:44/221 - (19%)
Similarity:70/221 - (31%) Gaps:89/221 - (40%)


- Green bases have known domain annotations that are detailed below.


Human   342 LGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPA-----FSGL 401
            ||.:..:...||..:......|:| .|..|:    .|.:.:.:|      ...:|.     |.|:
  Fly   370 LGYEVHLVDTLEKDILQRHPCIKW-TDVAGL----NEAKTILQE------AVVLPVIMPEFFKGI 423

Human   402 YAPYWEPSARGII-------------------CGLTQF-------TNKCHIAFAALEAVCFQTRE 440
            ..|:     ||::                   ||.|.|       |:|.......|..:.|:...
  Fly   424 RRPW-----RGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMAR 483

Human   441 I----------LDAMNRDCGIPLSH-----------LQVDG---GMTSNKILMQLQA-----DI- 475
            .          :||:....|....|           :|:||   .|...|::|.|.|     || 
  Fly   484 FYAPSTIFIDEIDALCASRGSDSEHEASRRFKAELLIQMDGLNASMQEEKVIMVLAATNHPWDID 548

Human   476 ----------LYIPVVKPSMPETTAL 491
                      :|||:  |:....:||
  Fly   549 EAFRRRFEKRIYIPL--PNEGTRSAL 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GKXP_011543793.1 FGGY_GK1-3_metazoa 11..547 CDD:212664 44/221 (20%)
kat-60L1NP_001163523.1 AAA 426..565 CDD:214640 28/145 (19%)
AAA 430..563 CDD:278434 24/132 (18%)
Vps4_C <638..671 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.