DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GK and CG1271

DIOPT Version :9

Sequence 1:XP_011543793.1 Gene:GK / 2710 HGNCID:4289 Length:587 Species:Homo sapiens
Sequence 2:NP_647763.1 Gene:CG1271 / 38364 FlyBaseID:FBgn0035392 Length:556 Species:Drosophila melanogaster


Alignment Length:578 Identity:153/578 - (26%)
Similarity:248/578 - (42%) Gaps:102/578 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    15 AVDQGTSSTRFLVFNSK---------TAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEK 70
            |:|.||:..|..|.:.:         ..|||:          |:.|:.|.:|:.:...:...|.:
  Fly    35 ALDVGTTCVRSFVLDEQCEVRGSAVDAVELLN----------PQPGYFEIEPESLWRKIVGVITQ 89

Human    71 TCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVAAPVSPGPSVPVAVVPSGSSVPA 135
            .. |..||.  ..:|..:.:|.||.|.:.||..:||..:|.:                       
  Fly    90 AV-KNAQLT--PPDITCLTISTQRCTFLTWDHRSGEYYHNFI----------------------- 128

Human   136 PGTSSVWLDLRTQSTVESLSKRIPGNNNFVKSK------------------TGLPLSTYFSAVKL 182
                 .|.|||....|:.      .|.::.||.                  .|..|......|..
  Fly   129 -----TWKDLRADELVDQ------WNASWTKSSMNWFSYALFLLTRQSRFLAGSVLQLMNGQVTP 182

Human   183 RWLLD--NVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGG---VHCTDVTNASRTMLFNIHSLE 242
            |.|.:  |.:|:::|:.:|:|....:|||::..|..|.:..   .|.||||:::.|.|::..:|.
  Fly   183 RLLFEIMNNKKLKQALMQKKARVELLDSWILHKLRTGSSRDKDVEHITDVTSSTATGLYDPFTLS 247

Human   243 WDKQLCEFFGIPMEILPNVRSSSEIYGLMKISHSVKAG---ALEGVPISGCLGDQSAALVGQMCF 304
            |...:...|||..:|||.|..:.  |......|....|   |...:||:..|.||:||:.|..||
  Fly   248 WSPLISWLFGINSKILPRVVDNG--YKGFGHVHPTAFGPDWANTEIPIAASLSDQTAAIWGSQCF 310

Human   305 QIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAY---KLGRDKPVYYALEGSVAIAGAVIRWL 366
            |....|.|.|||.||...||.:|.....|:...||:   |..|.:...|.:||:....|.|:.|.
  Fly   311 QKNDVKVTMGTGAFLNLVTGDRCQAVISGMYPLVAWQFKKPTRQQGAVYCIEGASHDFGTVVTWA 375

Human   367 RDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWE-PSARGIICGLTQFTNKCHIAFAA 430
            : :..:..:......:|:.|..:...:|:||||||..|..: .||.|.| |||..|.|.|:..|.
  Fly   376 Q-SCELFDSPANTSDIAQSVPDTNDVFFMPAFSGLGPPVNDYRSASGFI-GLTPSTTKAHMVRAL 438

Human   431 LEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAM 495
            ||::.|:..::::|..::....|..::||||::.|..:.|..||:..:.|.:....|::.:||..
  Fly   439 LESIVFRLVQLIEAAEKETSQKLHMIRVDGGVSRNDFVCQFLADLSRLRVERADNAESSIMGATF 503

Human   496 AAGAAEGVGVWSLEPEDLSAVTMER-----FEPQINAEES-EIRYSTWKKAVMKSMGW 547
            .||.  .:|:|    .|::.:...|     |||:....|: ..|...|.:.:.:...|
  Fly   504 MAGI--NLGIW----RDVNDLKRFRKVARVFEPRPKEYETIANRMDKWSRTIARFSDW 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GKXP_011543793.1 FGGY_GK1-3_metazoa 11..547 CDD:212664 152/576 (26%)
CG1271NP_647763.1 GlpK 32..555 CDD:223628 152/576 (26%)
FGGY_GK5_metazoa 32..552 CDD:212665 152/573 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352321at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.