DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GK and Rpt6

DIOPT Version :9

Sequence 1:XP_011543793.1 Gene:GK / 2710 HGNCID:4289 Length:587 Species:Homo sapiens
Sequence 2:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster


Alignment Length:147 Identity:29/147 - (19%)
Similarity:58/147 - (39%) Gaps:24/147 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   361 AVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGII-----CGLTQF 420
            |.:|.||:.|          :|.:|.|:..|....|...........|..:.::     ..:...
  Fly    53 AKVRMLREEL----------QLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDV 107

Human   421 TNKCHIAFA----ALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVV 481
            |..|.:|..    .|..:.....:.|.::.....:|.|..::.||:  :|.:.::: :::.:||.
  Fly   108 TPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGL--DKQIKEIK-EVIELPVK 169

Human   482 KPSMPETTALGAAMAAG 498
            .|.:.:  |||.|...|
  Fly   170 HPELFD--ALGIAQPKG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GKXP_011543793.1 FGGY_GK1-3_metazoa 11..547 CDD:212664 29/147 (20%)
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 29/147 (20%)
SlyX <27..>69 CDD:294687 7/25 (28%)
AAA_16 152..>205 CDD:289934 10/38 (26%)
AAA 185..317 CDD:278434 29/147 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.