DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B3GAT1 and GlcAT-S

DIOPT Version :9

Sequence 1:NP_001354902.1 Gene:B3GAT1 / 27087 HGNCID:921 Length:347 Species:Homo sapiens
Sequence 2:NP_001162922.1 Gene:GlcAT-S / 34282 FlyBaseID:FBgn0032135 Length:486 Species:Drosophila melanogaster


Alignment Length:328 Identity:114/328 - (34%)
Similarity:160/328 - (48%) Gaps:58/328 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    50 KDEGSD--PRRETPPG---------------------------------ADPREYCTSDRDIVEV 79
            |.||.|  |..|..||                                 .|||.:..:.|.:.|.
  Fly   117 KHEGDDRNPGEEEFPGNLSHRAQEIYEYEWNFKIEEQTTKQMQIRNRHRFDPRIHSMNFRPLNET 181

Human    80 V---------RTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVVED 135
            |         |.:::..:|......||.|:.|||||.|..|..||||:|:||||:|.|||||.:|
  Fly   182 VHICSESYEDRRQFMQDKPQSDYVQLPVIYFVTPTYPRREQIPELTRLAHTLLHIPRLHWLVADD 246

Human   136 APRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRNSSQ 200
            ..:.......||...|:.:||:....|..::     .:...|||...|..||:|:|:    ::..
  Fly   247 QEKCNDYMDTLLYRFGMPFTHMVSPMPSKFR-----NEKPAPRGVANRRAALQWIRQ----HNLT 302

Human   201 PGVVYFADDDNTYSLELFEEMRSTRRVSVWPVAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFA 265
            .|::||.||||||.|.||.|:|.|:|||::||..:.......|.|. .||||.:...:...|.:.
  Fly   303 NGILYFGDDDNTYDLRLFSEIRKTQRVSMFPVGLIADYGVSGPVVR-KGKVVAFLDSWVAGRRWP 366

Human   266 IDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLREL-VTLNDLEPKAANCTKILVWHTRTEK 329
            :|||||||||..:.|  ..|..: ..|.||:|...||.: :.:|.:||:..|||:||||||:|:.
  Fly   367 VDMAGFAVNLEYMAQ--YPYVNM-PYKPGYEEDLFLRSIGLQMNLIEPRGNNCTEILVWHTQTKS 428

Human   330 PVL 332
            ..|
  Fly   429 KKL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B3GAT1NP_001354902.1 None
GlcAT-SNP_001162922.1 GlcAT-I 208..427 CDD:132995 95/231 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.