DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPP1 and YPR158W-A

DIOPT Version :9

Sequence 1:NP_055210.2 Gene:DAPP1 / 27071 HGNCID:16500 Length:280 Species:Homo sapiens
Sequence 2:NP_058194.1 Gene:YPR158W-A / 856282 SGDID:S000007363 Length:440 Species:Saccharomyces cerevisiae


Alignment Length:39 Identity:12/39 - (30%)
Similarity:19/39 - (48%) Gaps:2/39 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   230 LVFPFRTFYLCAKTGVEADEWIK-ILRWKLSQIRKQLNQ 267
            |.|.:.||.:.|.:.. ...|:| ||....:.|.|.|::
Yeast   217 LTFLYNTFQIFAPSQF-LPTWVKDILSVDYTDIMKILSK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPP1NP_055210.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SH2_DAPP1_BAM32_like 28..119 CDD:198218
PH_DAPP1 163..258 CDD:269977 9/28 (32%)
YPR158W-ANP_058194.1 TYA 17..114 CDD:279373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0017
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.