powered by:
Protein Alignment DAPP1 and YOR343W-A
DIOPT Version :9
Sequence 1: | NP_055210.2 |
Gene: | DAPP1 / 27071 |
HGNCID: | 16500 |
Length: | 280 |
Species: | Homo sapiens |
Sequence 2: | NP_620390.1 |
Gene: | YOR343W-A / 854522 |
SGDID: | S000007355 |
Length: | 438 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 66 |
Identity: | 17/66 - (25%) |
Similarity: | 33/66 - (50%) |
Gaps: | 8/66 - (12%) |
- Green bases have known domain annotations that are detailed below.
Human 92 FKFGFNEF---SSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRT 153
||:..|:: :::| ..:.||...||..|...:.:.| |.:.::.|.|::|. .|:..|..|
Yeast 317 FKYLRNQYRTKTNMK-LSQLFAEIQLIYDENKIMNLNK---PSQYKQHSEYKNVS-RTSPNTTNT 376
Human 154 E 154
:
Yeast 377 K 377
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0017 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.