DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPP1 and Socs36E

DIOPT Version :9

Sequence 1:NP_055210.2 Gene:DAPP1 / 27071 HGNCID:16500 Length:280 Species:Homo sapiens
Sequence 2:NP_523593.5 Gene:Socs36E / 35085 FlyBaseID:FBgn0041184 Length:737 Species:Drosophila melanogaster


Alignment Length:232 Identity:53/232 - (22%)
Similarity:91/232 - (39%) Gaps:48/232 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    26 EAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGY 90
            :.|.:.:..:|.|.:.|:.||. ||....:|::|||||.:...|:|::.|......|..:|.:|:
  Fly   465 DLEKITNSSFYWGKMDRYEAEH-LLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARIEQSGH 528

Human    91 SFKFGFNE---FSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVH-----TA 147
            .|.|..::   |::           |.:   ||.|...|.|......||.:  ::.:|     :.
  Fly   529 KFSFDCHDPCVFTA-----------PTV---TGLLEHYKDPACVMFFEPCL--TIPLHRRQTFSL 577

Human   148 MQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTE 212
            .|..|.  .:|......|..:..|.   |.:|::...:....:..:|.. ||.:|.|..... .|
  Fly   578 QQLSRA--TIVSNTSYDGINQMELP---GRLKSYLKEYHYKQKLRVKPI-DQNTPMPYYGNVXRE 636

Human   213 CSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADE 249
            ...|.|                 |:|...::|.|.||
  Fly   637 EQQVGF-----------------TYYEDVESGSEVDE 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPP1NP_055210.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SH2_DAPP1_BAM32_like 28..119 CDD:198218 24/93 (26%)
PH_DAPP1 163..258 CDD:269977 18/87 (21%)
Socs36ENP_523593.5 SH2 463..563 CDD:301589 29/112 (26%)
SOCS 575..626 CDD:295349 10/56 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.