DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPP1 and dock

DIOPT Version :9

Sequence 1:NP_055210.2 Gene:DAPP1 / 27071 HGNCID:16500 Length:280 Species:Homo sapiens
Sequence 2:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster


Alignment Length:124 Identity:39/124 - (31%)
Similarity:58/124 - (46%) Gaps:16/124 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    22 RSDGEAELLQDLG------------WYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSV 74
            |::|.....|..|            ||:|.:||...:.:|..:|.||.:|:|||....|.||:|:
  Fly   423 RNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCDTVLNGHGHDGDFLIRDSETNMGDYSVSL 487

Human    75 RAKDSVKHF--HVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPR 131
            :|....|||  |||...|.  .|..:|.||...|.|:...|:..::.|..:.|....|:
  Fly   488 KAPGRNKHFRVHVEQNMYC--IGQRKFHSLDQLVDHYQRAPIYTNKQGEKLYLVRSLPK 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPP1NP_055210.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SH2_DAPP1_BAM32_like 28..119 CDD:198218 34/104 (33%)
PH_DAPP1 163..258 CDD:269977
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701
SH2_Nck_family 446..538 CDD:198196 33/93 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.