DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STAU2 and loqs

DIOPT Version :9

Sequence 1:NP_001157852.1 Gene:STAU2 / 27067 HGNCID:11371 Length:570 Species:Homo sapiens
Sequence 2:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster


Alignment Length:526 Identity:114/526 - (21%)
Similarity:181/526 - (34%) Gaps:170/526 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    73 STLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQR 137
            |:||:.:|     |::..|...:|.....|.|.:|               :|.   |..|:    
  Fly     9 SSLPQQLQ-----NLHIQPQQASPNPVQTGFAPRR---------------HYN---NLVGL---- 46

Human   138 YHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQNEPIPERSPQNGESGK----DV 198
                           ||.........:.|......:|    |:.|.|..:..|..:.|:    ||
  Fly    47 ---------------GNGNAVSGSPVKGAPLGQRHVK----LKKEKISAQVAQLSQPGQLQLSDV 92

Human   199 DD------------------------------DKDAN----KSEISLVFEIALKRNMPVSFEVIK 229
            .|                              :.|||    |:.:|::.|:..:|.:...:|:::
  Fly    93 GDPALAGGSGLQGGVGLMGVILPSDEALKFVSETDANGLAMKTPVSILQELLSRRGITPGYELVQ 157

Human   230 ESGPPHMKSFVTRVSVGE----FSAEGEGNSKKLSKKRAATTVLQEL--KKLPPLPVVEKPKLFF 288
            ..|..|..:|..|||..:    |:|.|.|.|||.:|..||..::.:|  .:||     |.|.   
  Fly   158 IEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGAQLP-----ESPS--- 214

Human   289 KKRPKTIVKAGPEY---------GQGM---------------NPISRLAQIQQAKKEKEPDYVLL 329
                   ..|||..         |.|.               |||..|.::...::...|.|...
  Fly   215 -------SSAGPSVTGLTVAGSGGDGNANATGGGDASDKTVGNPIGWLQEMCMQRRWPPPSYETE 272

Human   330 SERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQL------GYKASTNLQDQLE-- 386
            :|.|:|..|.|.:...:.|....|.|.:|||||:.||..|.::|      ..|.|.::..:||  
  Fly   273 TEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRMWMRLQETPIDSGKISDSICGELEGE 337

Human   387 -KTGENKGWSGPKPGFPEPT-----------------NNTPKGILHLSPDVYQEMEASRHKVISG 433
             ::.||  :.|.......||                 |.|.|.:|.|     |:.....:|:...
  Fly   338 PRSSEN--YYGELKDISVPTLTTQHSNKVSQFHKTLKNATGKKLLKL-----QKTCLKNNKIDYI 395

Human   434 TTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNGTSSTAEAIGLKGSSPTPPCSPVQPSK 498
            ..||.::.:  ||     |.::.......|.:.:.......||.......||.||...:....::
  Fly   396 KLLGEIATE--NQ-----FEVTYVDIEEKTFSGQFQCLVQLSTLPVGVCHGSGPTAADAQRHAAQ 453

Human   499 Q-LEYL 503
            . ||||
  Fly   454 NALEYL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STAU2NP_001157852.1 DSRM 9..70 CDD:214634
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..94 6/20 (30%)
DSRM 96..180 CDD:214634 11/83 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..203 7/55 (13%)
DSRM 209..273 CDD:214634 21/69 (30%)
Nuclear localization signal 1. /evidence=ECO:0000250 273..291 4/17 (24%)
DSRM 308..374 CDD:214634 22/71 (31%)
Nuclear localization signal 2. /evidence=ECO:0000250 373..412 13/64 (20%)
Required for dendritic transport. /evidence=ECO:0000250 381..570 30/144 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..409 6/38 (16%)
Staufen_C 459..523 CDD:318642 11/46 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 528..570
loqsNP_609646.1 DSRM 136..204 CDD:214634 20/67 (30%)
DSRM 250..316 CDD:238007 22/65 (34%)
DSRM 394..460 CDD:214634 16/73 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158158
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.