DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp9 and Fkbp14

DIOPT Version :9

Sequence 1:NP_036186.2 Gene:Fkbp9 / 27055 MGIID:1350921 Length:570 Species:Mus musculus
Sequence 2:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster


Alignment Length:205 Identity:72/205 - (35%)
Similarity:109/205 - (53%) Gaps:31/205 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse   379 PPDCSVLSKKGDYLKYHYNASL-LDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKR 442
            |..|...||.||.|..||..:| .||...||:::..:.:...||:|||:.|.|.||..|||||||
  Fly    34 PEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKR 98

Mouse   443 TVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVSGLPEGYMFIWNGEVSPNLFEEIDRDGNGE 507
            .:.|||.||||:.|....:|..|.|:||:||:.           |.|...:.|:|:|||.:.:.:
  Fly    99 KLTIPPQLGYGDQGAGNVIPPKATLLFDVELIN-----------IGNAPPTTNVFKEIDDNADKQ 152

Mouse   508 VLLEE----FSEYIHAQVATGKGK--------LAPGFNAEMIVKNMFTNQDRNGDGKVTAEEFKL 560
            :..||    .|||:..|:...:|:        ||..   :.:|:.:|.::|::.:|.::.:||  
  Fly   153 LSREEVIVYVSEYLKKQMTAVEGQDSEELKNMLAEN---DKLVEEIFQHEDKDKNGFISHDEF-- 212

Mouse   561 KDQEAKHDEL 570
              ...|||||
  Fly   213 --SGPKHDEL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp9NP_036186.2 FKBP_C 47..139 CDD:278674
FKBP_C 159..251 CDD:278674
FKBP_C 271..362 CDD:278674
FKBP_C 382..474 CDD:278674 43/92 (47%)
EF-hand_7 495..559 CDD:290234 19/75 (25%)
EFh 497..558 CDD:238008 17/72 (24%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 567..570 2/2 (100%)
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 43/92 (47%)
EF-hand_7 140..212 CDD:290234 18/74 (24%)
EFh 141..212 CDD:298682 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.