Sequence 1: | NP_036186.2 | Gene: | Fkbp9 / 27055 | MGIID: | 1350921 | Length: | 570 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246448.1 | Gene: | Fkbp14 / 37449 | FlyBaseID: | FBgn0010470 | Length: | 220 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 72/205 - (35%) |
---|---|---|---|
Similarity: | 109/205 - (53%) | Gaps: | 31/205 - (15%) |
- Green bases have known domain annotations that are detailed below.
Mouse 379 PPDCSVLSKKGDYLKYHYNASL-LDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKR 442
Mouse 443 TVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVSGLPEGYMFIWNGEVSPNLFEEIDRDGNGE 507
Mouse 508 VLLEE----FSEYIHAQVATGKGK--------LAPGFNAEMIVKNMFTNQDRNGDGKVTAEEFKL 560
Mouse 561 KDQEAKHDEL 570 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fkbp9 | NP_036186.2 | FKBP_C | 47..139 | CDD:278674 | |
FKBP_C | 159..251 | CDD:278674 | |||
FKBP_C | 271..362 | CDD:278674 | |||
FKBP_C | 382..474 | CDD:278674 | 43/92 (47%) | ||
EF-hand_7 | 495..559 | CDD:290234 | 19/75 (25%) | ||
EFh | 497..558 | CDD:238008 | 17/72 (24%) | ||
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 | 567..570 | 2/2 (100%) | |||
Fkbp14 | NP_001246448.1 | FKBP_C | 37..130 | CDD:278674 | 43/92 (47%) |
EF-hand_7 | 140..212 | CDD:290234 | 18/74 (24%) | ||
EFh | 141..212 | CDD:298682 | 17/73 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1507309at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |