DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ZBTB32 and CG6654

DIOPT Version :9

Sequence 1:	XP_016882077.1	Gene:	ZBTB32 / 27033	HGNCID:	16763	Length:	523	Species:	Homo sapiens
Sequence 2:	NP_650429.1	Gene:	CG6654 / 41831	FlyBaseID:	FBgn0038301	Length:	639	Species:	Drosophila melanogaster

Alignment Length:	109	Identity:	34/109 - (31%)
Similarity:	47/109 - (43%)	Gaps:	29/109 - (26%)

- Green bases have known domain annotations that are detailed below.

Human   407 RPYACSVCGKRFSLKHQMETHYRVHTGEKPFSCSLCPQRSRDFSAMTKHLRTH-GAAPYRCSLCG 470
            :|:.|.||..||:....:..|.|.||||:|::|.|||.|....:.:..|.||| |..||.|..|.
  Fly   494 KPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCS 558

Human   471 AG---------------------CP-------SLASMQAHMRGH 486
            ..                     ||       |:..|::|:.||
  Fly   559 KTFTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGH 602

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ZBTB32	XP_016882077.1	None
CG6654	NP_650429.1	zf-AD	6..79	CDD:285071
		C2H2 Zn finger	331..354	CDD:275368
		COG5048	<357..570	CDD:227381	27/75 (36%)
		C2H2 Zn finger	360..380	CDD:275368
		C2H2 Zn finger	385..406	CDD:275370
		C2H2 Zn finger	414..434	CDD:275368
		zf-H2C2_2	427..451	CDD:290200
		C2H2 Zn finger	442..490	CDD:275368
		C2H2 Zn finger	470..487	CDD:275368
		zf-H2C2_2	482..507	CDD:290200	6/12 (50%)
		C2H2 Zn finger	498..518	CDD:275368	7/19 (37%)
		zf-H2C2_2	510..534	CDD:290200	12/23 (52%)
		C2H2 Zn finger	526..546	CDD:275368	7/19 (37%)
		zf-H2C2_2	539..563	CDD:290200	9/23 (39%)
		C2H2 Zn finger	554..574	CDD:275368	2/19 (11%)
		C2H2 Zn finger	582..602	CDD:275368	5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000