DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FOXB1 and FoxK

DIOPT Version :9

Sequence 1:NP_036314.2 Gene:FOXB1 / 27023 HGNCID:3799 Length:325 Species:Homo sapiens
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:253 Identity:83/253 - (32%)
Similarity:120/253 - (47%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     4 PGRNTYS-DQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQR-WQNSLRHNLS 66
            |...:|: ::||||||..|...||.::|:|.|.||.||.||:..:||||:.|.: ||||:|||||
  Fly   443 PSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLS 507

Human    67 FNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKR--------FKVLKSDHLAPSKPA 123
            .|..|||:.|..|:|||||||.:.|..|....:.|:.:||:|        :.:.:|..::||...
  Fly   508 LNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSHMD 572

Human   124 DAAQYLQQQAKLRLSALAASGTHLPQM---PAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGG 185
            ::.:....|..:..||..:.|..|.|.   |...||.....|....:.....:..::.....   
  Fly   573 NSRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQNAHQQQQQQQQQQQQQTLSNNSNQ--- 634

Human   186 LAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYGSAGMIDSATPISMASGDYSAYGV 243
              :|:..|    |.:.||    .|.:.|...||.|||           |||.....||
  Fly   635 --YSSGSP----YYVTNQ----SSGVATPQTHVEGSA-----------ASGGGGGGGV 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FOXB1NP_036314.2 FH_FOXB2 1..110 CDD:410817 53/115 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..325
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 47/86 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.